Comparing Synpcc7942_1037 FitnessBrowser__SynE:Synpcc7942_1037 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3nzqA Crystal structure of biosynthetic arginine decarboxylase adc (spea) from escherichia coli, northeast structural genomics consortium target er600 (see paper)
42% identity, 95% coverage: 29:644/647 of query aligns to 6:622/628 of 3nzqA
Q9SI64 Arginine decarboxylase 1, chloroplastic; ADC 1; ADC-O; ARGDC 1; AtADC1; EC 4.1.1.19 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 93% coverage: 12:614/647 of query aligns to 26:627/702 of Q9SI64
3n2oA X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
36% identity, 96% coverage: 21:644/647 of query aligns to 1:628/630 of 3n2oA
3n2oB X-ray crystal structure of arginine decarboxylase complexed with arginine from vibrio vulnificus (see paper)
36% identity, 96% coverage: 27:644/647 of query aligns to 6:627/629 of 3n2oB
3nzpB Crystal structure of the biosynthetic arginine decarboxylase spea from campylobacter jejuni, northeast structural genomics consortium target br53 (see paper)
34% identity, 92% coverage: 29:621/647 of query aligns to 4:559/591 of 3nzpB
Sites not aligning to the query:
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
28% identity, 38% coverage: 125:368/647 of query aligns to 23:274/394 of 3c5qA
Sites not aligning to the query:
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
28% identity, 38% coverage: 125:368/647 of query aligns to 25:276/405 of B4XMC6
Sites not aligning to the query:
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
30% identity, 18% coverage: 260:373/647 of query aligns to 211:319/442 of 5x7nA
Sites not aligning to the query:
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
30% identity, 18% coverage: 260:373/647 of query aligns to 211:319/443 of 5x7mA
Sites not aligning to the query:
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
25% identity, 40% coverage: 113:368/647 of query aligns to 42:262/385 of 2yxxA
Sites not aligning to the query:
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
25% identity, 40% coverage: 113:368/647 of query aligns to 43:263/386 of Q9X1K5
Sites not aligning to the query:
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
27% identity, 36% coverage: 138:367/647 of query aligns to 90:316/447 of P9WIU7
Sites not aligning to the query:
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
27% identity, 36% coverage: 138:367/647 of query aligns to 89:315/446 of 1hkvA
Sites not aligning to the query:
7kh2D Structure of n-citrylornithine decarboxylase bound with plp (see paper)
23% identity, 33% coverage: 160:372/647 of query aligns to 103:306/415 of 7kh2D
Sites not aligning to the query:
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
24% identity, 22% coverage: 226:369/647 of query aligns to 165:296/422 of 6n2aA
Sites not aligning to the query:
2nvaA The x-ray crystal structure of the paramecium bursaria chlorella virus arginine decarboxylase bound to agmatine (see paper)
23% identity, 45% coverage: 77:369/647 of query aligns to 19:267/369 of 2nvaA
Sites not aligning to the query:
2nv9B The x-ray crystal structure of the paramecium bursaria chlorella virus arginine decarboxylase (see paper)
23% identity, 45% coverage: 77:369/647 of query aligns to 19:270/372 of 2nv9B
Sites not aligning to the query:
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
26% identity, 23% coverage: 226:374/647 of query aligns to 176:317/438 of Q58497
Sites not aligning to the query:
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
25% identity, 23% coverage: 226:374/647 of query aligns to 172:313/434 of 1tufA
Sites not aligning to the query:
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
25% identity, 23% coverage: 226:374/647 of query aligns to 172:313/434 of 1twiA
Sites not aligning to the query:
>Synpcc7942_1037 FitnessBrowser__SynE:Synpcc7942_1037
MAAEQTAIAPLAVAVESQQWRIEDSEALYRIQGWGEPYFGINAAGHITVSPQGDRGGSLD
LYELVEALRRRGLNLPLLIRFPDILEDRIERLNACFAKAIARYNYAGEYRGVFPVKCNQQ
RHLIESLVNYGRPFQFGLEAGSKPELLIALAHLDTPGALLICNGYKDRDYIETAILGRRL
GKTPILVIEQLEEVDVAIAASQRLGIEPILGVRAKLNARGMGRWGSSAGDRAKFGLTMPE
IVAAVEKLQAANLLHCLQLLHFHIGSQISDISVLKDAIQEAAQIYVQLAALGADMRYLDV
GGGLGVDYDGSKTNFHASKNYNMQTYANDVVATIKDACQAHRLAVPTLTSESGRAIASHQ
SVLVFDVLGSSEVPRAAVEPPQEEDSAIVRTLYEVLEAIALENLQECYHDAFKLKEDAVS
AFRLGYLSLTERAKAERLFWSCCHRIQEFLKQLDRIPEDLEDLERVMASIYYVNLSVFQS
APDTWAIDQLFPIMPIHRLNEEPNQRVTLADLTCDSDGKIDRFIDLLDVKSTLELHSLQP
DQPYVLGMFLGGAYQEIMGNLHNLFGDTNAVHIKLTPKGYSIEHVVKGDTMGEVLGYVQY
DTEQLLERLRQQTEAALQQDQISLDEAQRLLRHYEEGLQRYTYLSLD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory