SitesBLAST
Comparing Synpcc7942_1149 FitnessBrowser__SynE:Synpcc7942_1149 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8NBZ7 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UGD; UXS-1; hUXS; hUXS1; EC 4.1.1.35 from Homo sapiens (Human) (see 4 papers)
65% identity, 96% coverage: 3:313/325 of query aligns to 90:400/420 of Q8NBZ7
- G98 (= G11) binding
- F99 (= F12) binding
- V100 (≠ I13) binding
- D119 (= D32) binding
- N120 (= N33) binding
- F122 (= F35) binding
- T123 (= T36) binding
- G124 (= G37) binding
- D144 (= D57) binding
- V145 (≠ I58) binding
- L149 (≠ I62) binding
- Y150 (≠ R63) binding
- L159 (= L72) binding
- S161 (≠ C74) binding
- K177 (= K90) binding
- T178 (= T91) binding
- N185 (= N98) binding
- G188 (= G101) binding
- K191 (= K104) binding
- R192 (= R105) binding
- A200 (= A113) binding
- E204 (= E117) mutation to A: Reduced UDP-glucuronic acid decarboxylase activity.
- Y231 (= Y144) active site, Proton acceptor; binding ; mutation to F: Abolished UDP-glucuronic acid decarboxylase activity.
- K235 (= K148) binding
- R236 (= R149) mutation to H: Strongly reduced UDP-glucuronic acid decarboxylase activity, caused by a local unfolding of the active site that allows for a rotation of the dimer interface, leading to the formation of a homohexamer.
- Y245 (= Y158) binding
- Q248 (= Q161) binding
- E249 (≠ H162) binding
- T261 (= T174) binding
- H267 (≠ L180) binding
- R272 (= R185) binding
- R361 (= R274) mutation to Q: Strongly reduced UDP-glucuronic acid decarboxylase activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2b69A Crystal structure of human udp-glucoronic acid decarboxylase
65% identity, 95% coverage: 3:312/325 of query aligns to 3:312/312 of 2b69A
- active site: T115 (= T115), S116 (= S116), E117 (= E117), Y144 (= Y144), K148 (= K148), R185 (= R185)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), V13 (≠ I13), D32 (= D32), N33 (= N33), T36 (= T36), G37 (= G37), D57 (= D57), V58 (≠ I58), L72 (= L72), A73 (= A73), S74 (≠ C74), A76 (= A76), T91 (= T91), T115 (= T115), Y144 (= Y144), K148 (= K148), I171 (= I171), N173 (= N173), R185 (= R185)
- binding uridine-5'-diphosphate: P61 (= P61), L62 (≠ I62), Y63 (≠ R63), P78 (= P78), N98 (= N98), G101 (= G101), L102 (= L102), K104 (= K104), R105 (= R105), Y158 (= Y158), N173 (= N173), R185 (= R185), V186 (= V186), N189 (= N189), T201 (= T201), Y203 (= Y203), Q208 (= Q208), R210 (= R210), I244 (= I244), D270 (= D270)
Q6GMI9 UDP-glucuronic acid decarboxylase 1; UDP-glucuronate decarboxylase 1; UXS-1; EC 4.1.1.35 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
66% identity, 93% coverage: 3:304/325 of query aligns to 88:389/418 of Q6GMI9
- R234 (= R149) mutation to H: In Man o' war (mow) mutant; characterized by severe craniofacial defects. Fishes show defective organization and morphogenesis of chondrocytes, perichondrium and bone.
4lk3B Crystal structure of human udp-xylose synthase r236a substitution (see paper)
56% identity, 95% coverage: 3:312/325 of query aligns to 3:274/274 of 4lk3B
- active site: T112 (= T115), S113 (= S116), E114 (= E117), K119 (= K148), R156 (= R185)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), V13 (≠ I13), D32 (= D32), N33 (= N33), T36 (= T36), G37 (= G37), D57 (= D57), V58 (≠ I58), L72 (= L72), A73 (= A73), S74 (≠ C74), P75 (= P75), T88 (= T91), A110 (= A113), T112 (= T115), K119 (= K148), I142 (= I171), H151 (≠ L180)
- binding uridine-5'-diphosphate: R156 (= R185), V157 (= V186), N160 (= N189), T172 (= T201), Y174 (= Y203), Q179 (= Q208), R181 (= R210), I215 (= I244)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P61), L62 (≠ I62), Y63 (≠ R63), I83 (= I86), K87 (= K90), N95 (= N98), G98 (= G101), L99 (= L102), K101 (= K104), Y129 (= Y158), E133 (≠ H162)
4lk3C Crystal structure of human udp-xylose synthase r236a substitution (see paper)
55% identity, 95% coverage: 3:312/325 of query aligns to 3:271/271 of 4lk3C
- active site: T110 (= T115), S111 (= S116), E112 (= E117), K117 (= K148), R154 (= R185)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), V13 (≠ I13), D32 (= D32), N33 (= N33), T36 (= T36), G37 (= G37), D57 (= D57), V58 (≠ I58), L72 (= L72), A73 (= A73), S74 (≠ C74), P75 (= P75), T86 (= T91), K117 (= K148), I140 (= I171), H149 (≠ L180)
- binding pyrophosphate 2-: R154 (= R185), V155 (= V186)
- binding uridine-5'-diphosphate-glucuronic acid: P61 (= P61), L62 (≠ I62), Y63 (≠ R63), N93 (= N98), G96 (= G101), L97 (= L102), K99 (= K104), R100 (= R105), Y127 (= Y158), E131 (≠ H162)
4m55E Crystal structure of human udp-xylose synthase r236h substitution (see paper)
46% identity, 72% coverage: 3:236/325 of query aligns to 1:156/164 of 4m55E
- active site: T105 (= T115)
- binding nicotinamide-adenine-dinucleotide: G6 (= G8), G9 (= G11), F10 (= F12), V11 (≠ I13), D30 (= D32), N31 (= N33), F32 (≠ Y34), T34 (= T36), G35 (= G37), D55 (= D57), V56 (≠ I58), S72 (≠ C74), P73 (= P75), T81 (= T91), T105 (= T115), T131 (= T174)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
31% identity, 91% coverage: 2:298/325 of query aligns to 1:304/314 of 6zldA
- active site: T126 (= T115), S127 (= S116), S128 (≠ E117), Y149 (= Y144), K153 (= K148)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D32), H33 (≠ N33), F34 (≠ Y34), I35 (≠ F35), K43 (≠ R38), D62 (= D57), I63 (= I58), L81 (= L72), A82 (= A73), A83 (≠ C74), I124 (≠ A113), T126 (= T115), K153 (= K148), Y176 (≠ I171), T178 (≠ N173), R185 (≠ N182), M188 (≠ R185)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (= P75), R88 (≠ P78), T126 (= T115), S127 (= S116), S128 (≠ E117), Y149 (= Y144), F177 (= F172), T178 (≠ N173), R185 (≠ N182), M188 (≠ R185), A189 (≠ V186), R192 (≠ N189), T204 (= T201), F206 (≠ Y203), Q211 (= Q208), R213 (= R210), I250 (= I244), E276 (≠ D270)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
31% identity, 91% coverage: 2:298/325 of query aligns to 1:304/314 of 6zl6A
- active site: T126 (= T115), S127 (= S116), S128 (≠ E117), Y149 (= Y144), K153 (= K148)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D32), H33 (≠ N33), F34 (≠ Y34), I35 (≠ F35), K43 (≠ R38), D62 (= D57), I63 (= I58), L81 (= L72), A82 (= A73), A83 (≠ C74), I124 (≠ A113), T126 (= T115), K153 (= K148), Y176 (≠ I171), T178 (≠ N173), V179 (≠ T174), R185 (≠ N182), M188 (≠ R185)
- binding uridine-5'-diphosphate: T178 (≠ N173), A189 (≠ V186), R192 (≠ N189), T204 (= T201), F206 (≠ Y203), Q211 (= Q208), R213 (= R210), I250 (= I244), E276 (≠ D270)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
31% identity, 91% coverage: 2:298/325 of query aligns to 1:304/321 of 6zllA
- active site: T126 (= T115), S127 (= S116), S128 (≠ E117), Y149 (= Y144), K153 (= K148)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D32), H33 (≠ N33), F34 (≠ Y34), I35 (≠ F35), K43 (≠ R38), D62 (= D57), I63 (= I58), L81 (= L72), A82 (= A73), A83 (≠ C74), I124 (≠ A113), T126 (= T115), Y149 (= Y144), K153 (= K148), Y176 (≠ I171), V179 (≠ T174), R185 (≠ N182), M188 (≠ R185)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (= P75), V87 (≠ S77), R88 (≠ P78), T126 (= T115), S127 (= S116), Y149 (= Y144), T178 (≠ N173), R185 (≠ N182), A189 (≠ V186), R192 (≠ N189), T204 (= T201), F206 (≠ Y203), Q211 (= Q208), R213 (= R210), I250 (= I244), E276 (≠ D270)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
30% identity, 91% coverage: 2:298/325 of query aligns to 1:304/314 of 6zljA
- active site: T126 (= T115), S127 (= S116), S128 (≠ E117), F149 (≠ I138), K153 (= K148)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D32), H33 (≠ N33), F34 (≠ Y34), I35 (≠ F35), K43 (≠ R38), D62 (= D57), I63 (= I58), L81 (= L72), A82 (= A73), A83 (≠ C74), I124 (≠ A113), T126 (= T115), K153 (= K148), Y176 (≠ I171), T178 (≠ N173), V179 (≠ T174), R185 (≠ N182), M188 (≠ R185)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (= P75), R88 (≠ P78), T126 (= T115), S127 (= S116), S128 (≠ E117), F149 (≠ I138), F177 (= F172), T178 (≠ N173), R185 (≠ N182), M188 (≠ R185), A189 (≠ V186), R192 (≠ N189), T204 (= T201), F206 (≠ Y203), Q211 (= Q208), R213 (= R210), I250 (= I244), E276 (≠ D270)
6bwlA X-ray structure of pal from bacillus thuringiensis (see paper)
33% identity, 92% coverage: 2:300/325 of query aligns to 1:305/313 of 6bwlA
- active site: T122 (= T115), C123 (≠ S116), M124 (≠ E117), Y147 (= Y144), K151 (= K148)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D31 (= D32), N32 (= N33), L33 (≠ Y34), N35 (≠ T36), S36 (≠ G37), D57 (= D57), I58 (= I58), L79 (= L72), A80 (= A76), A81 (≠ S77), I83 (≠ V79), M120 (≠ A113), K151 (= K148), N176 (= N173), T177 (= T174)
- binding uridine-5'-diphosphate: N176 (= N173), G189 (≠ R185), V190 (= V186), N205 (≠ T201), I206 (≠ V202), Y207 (= Y203), Q212 (= Q208), R214 (= R210), I250 (= I244), E275 (≠ D270)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
30% identity, 94% coverage: 2:305/325 of query aligns to 1:305/309 of 4zrnA
- active site: T117 (≠ S114), G119 (≠ S116), A120 (≠ E117), Y143 (≠ I138), K147 (= K148), Y181 (≠ E181), G185 (≠ R185)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D31 (= D32), N32 (= N33), S34 (≠ F35), S35 (≠ T36), G36 (= G37), S51 (≠ D57), I52 (= I58), L73 (= L72), A74 (= A73), A75 (≠ C74), T92 (= T91), S115 (≠ M112), S116 (≠ A113), Y143 (≠ I138), K147 (= K148), Y170 (≠ I171), V173 (≠ T174)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S114), G119 (≠ S116), A120 (≠ E117), Y143 (≠ I138), N172 (= N173), G185 (≠ R185), V186 (= V186), H201 (≠ T201), F203 (≠ Y203), Y208 (≠ Q208), R210 (= R210), V244 (≠ I244), R267 (≠ P267), D270 (= D270)
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
30% identity, 91% coverage: 4:300/325 of query aligns to 18:319/336 of 6pnlA
- active site: S133 (= S116), C135 (vs. gap), G136 (≠ E117), Y159 (= Y144), K163 (= K148)
- binding nicotinamide-adenine-dinucleotide: G22 (= G8), G25 (= G11), C26 (≠ F12), D46 (= D32), N47 (= N33), L48 (≠ Y34), S49 (≠ F35), S50 (≠ T36), S51 (≠ G37), D68 (= D57), I69 (= I58), L89 (= L72), A91 (≠ C74), F93 (≠ A76), V108 (≠ T91), S131 (= S114), S133 (= S116), Y159 (= Y144), K163 (= K148), F186 (≠ I171), N188 (= N173), V189 (≠ T174), R200 (= R185)
- binding uridine-5'-diphosphate: N188 (= N173), N201 (vs. gap), V202 (= V186), F206 (= F190), P217 (≠ T201), I218 (≠ V202), T219 (≠ Y203), R226 (= R210), V262 (≠ I244), R285 (≠ P267)
6pmhA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
30% identity, 91% coverage: 4:300/325 of query aligns to 12:313/330 of 6pmhA
- active site: S127 (= S116), C129 (vs. gap), G130 (≠ E117), Y153 (= Y144), K157 (= K148)
- binding adenosine monophosphate: G16 (= G8), G19 (= G11), D40 (= D32), N41 (= N33), S43 (≠ F35), S44 (≠ T36), S45 (≠ G37), D62 (= D57), I63 (= I58), A84 (= A73), F87 (≠ A76), R194 (= R185)
- binding uridine-5'-diphosphate: C129 (vs. gap), N182 (= N173), N195 (vs. gap), V196 (= V186), F200 (= F190), P211 (≠ T201), I212 (≠ V202), T213 (≠ Y203), R220 (= R210), V256 (≠ I244), R279 (≠ P267)
6h0pA The structure of c100a mutant of arabidopsis thaliana udp-apiose/udp- xylose synthase in complex with nadh and udp-d-glucuronic acid (see paper)
28% identity, 96% coverage: 2:313/325 of query aligns to 11:372/375 of 6h0pA
- binding nicotinamide-adenine-dinucleotide: G17 (= G8), G20 (= G11), F21 (= F12), I22 (= I13), D42 (= D32), N69 (≠ D57), I70 (= I58), L89 (= L72), A90 (= A73), A91 (≠ C74), A93 (= A76), F130 (≠ A113), Y178 (= Y144), K182 (= K148)
- binding uridine-5'-diphosphate-glucuronic acid: P95 (= P78), Y98 (= Y81), T132 (= T115), E134 (= E117), R175 (vs. gap), Y178 (= Y144), N207 (= N173), R228 (= R185), V229 (= V186), C232 (≠ N189), F233 (= F190), V246 (≠ Y203), R253 (= R210), V291 (≠ I244), F323 (= F263), Y324 (≠ R264), Y328 (≠ Q268), D330 (= D270), R334 (= R274)
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
30% identity, 92% coverage: 3:300/325 of query aligns to 9:307/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G8), G17 (= G11), F18 (= F12), I19 (= I13), D37 (= D32), N38 (= N33), E40 (≠ K39), R41 (≠ H40), N61 (≠ D57), V62 (≠ I58), A81 (≠ L72), A82 (= A73), A83 (≠ C74), F124 (≠ A113), K154 (= K148), P177 (≠ I171), N179 (= N173)
- binding uridine-5'-diphosphate: R147 (= R141), G189 (≠ D183), A190 (≠ G184), M194 (≠ F190), Y205 (≠ T201), I206 (≠ V202), F207 (≠ Y203), R214 (= R210), I251 (= I244)
6h0nA The structure of wild-type arabidopsis thaliana udp-apiose/udp-xylose synthase in complex with NAD+ and udp (see paper)
28% identity, 96% coverage: 2:313/325 of query aligns to 11:372/377 of 6h0nA
- binding nicotinamide-adenine-dinucleotide: G17 (= G8), G20 (= G11), F21 (= F12), I22 (= I13), D42 (= D32), V43 (≠ N33), I68 (≠ H56), N69 (≠ D57), I70 (= I58), L89 (= L72), A90 (= A73), A91 (≠ C74), C93 (≠ A76), S131 (= S114), T132 (= T115), Y178 (= Y144), K182 (= K148), P205 (≠ I171), N207 (= N173), W208 (≠ T174), R228 (= R185)
- binding uridine-5'-diphosphate: P95 (= P78), R175 (vs. gap), R228 (= R185), V229 (= V186), C232 (≠ N189), V246 (≠ Y203), R253 (= R210), V291 (≠ I244), F323 (= F263), Y324 (≠ R264), Y328 (≠ Q268), D330 (= D270), R334 (= R274)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
30% identity, 86% coverage: 3:280/325 of query aligns to 5:282/310 of 6dntA
- active site: S120 (≠ T115), S121 (= S116), A122 (≠ E117), Y144 (= Y144), K148 (= K148), A187 (≠ R185)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (= A76), S120 (≠ T115), S121 (= S116), Y144 (= Y144), F172 (= F172), N173 (= N173), A187 (≠ R185), V188 (= V186), K191 (≠ N189), V203 (≠ T201), I204 (≠ V202), Y205 (= Y203), Q210 (= Q208), R212 (= R210), I246 (= I244), R269 (≠ P267), D272 (= D270)
- binding nicotinamide-adenine-dinucleotide: G10 (= G8), G13 (= G11), F14 (= F12), I15 (= I13), D33 (= D32), N34 (= N33), L35 (≠ Y34), S36 (≠ F35), S37 (≠ T36), G38 (= G37), D57 (= D57), L58 (≠ I58), L76 (= L72), A77 (= A73), A78 (≠ C74), A80 (= A76), S118 (≠ A113), S119 (= S114), Y144 (= Y144), K148 (= K148), Y171 (≠ I171), V174 (≠ T174)
- binding zinc ion: E209 (= E207), H275 (≠ Q273)
3eheA Crystal structure of udp-glucose 4 epimerase (gale-1) from archaeoglobus fulgidus
28% identity, 93% coverage: 4:304/325 of query aligns to 2:284/290 of 3eheA
- active site: T111 (= T115), S112 (= S116), T113 (≠ E117), Y135 (= Y144), K139 (= K148)
- binding nicotinamide-adenine-dinucleotide: G6 (= G8), G9 (= G11), F10 (= F12), I11 (= I13), D29 (= D32), N30 (= N33), L31 (≠ Y34), S32 (≠ F35), S33 (≠ T36), G34 (= G37), D49 (≠ E52), L50 (= L53), I68 (≠ L72), A69 (= A73), A70 (= A76), T109 (≠ A113), Y135 (= Y144), K139 (= K148), F162 (≠ I171), A163 (≠ F172), N164 (= N173), V165 (≠ T174)
8gjhA Salmonella arna (see paper)
27% identity, 93% coverage: 2:304/325 of query aligns to 299:632/639 of 8gjhA
- binding uridine-5'-diphosphate-glucuronic acid: A376 (= A76), P378 (= P78), Y381 (= Y81), S416 (= S116), R443 (= R141), N475 (= N173), R493 (= R185), A494 (≠ V186), K509 (≠ T201), I511 (≠ Y203), R518 (= R210), I557 (= I244), Y592 (vs. gap), R602 (= R274)
Query Sequence
>Synpcc7942_1149 FitnessBrowser__SynE:Synpcc7942_1149
MMRILVTGGAGFIGSHLIDRLMSAGHEVICLDNYFTGRKHNVAQWYGHPRFELIRHDITD
PIRLEVDQIYHLACPASPVHYQYNPIKTAKTSFLGTVNMLGLAKRVKARLLMASTSEVYG
DPHVHPQTEDYWGNVNPIGIRSCYDEGKRVAETLCFDYHRQHNLEIRVARIFNTYGPRML
ENDGRVVSNFIVQALQGQPLTVYGRGEQTRSFCYVSDLVDGLIRLMNGDHLGPVNLGNPS
EYTILQLAELIRDRIDPALPIEFRPLPQDDPQQRRPDISRAQAWLKWQPLVSVQDGLDRT
IADFRDRQQAAATLIADRLPEGSIS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory