Comparing Synpcc7942_1261 Synpcc7942_1261 triosephosphate isomerase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6bveA Triosephosphate isomerase of synechocystis in complex with 2- phosphoglycolic acid (see paper)
75% identity, 92% coverage: 22:262/263 of query aligns to 1:241/242 of 6bveA
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
51% identity, 90% coverage: 22:259/263 of query aligns to 1:247/253 of P00943
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
51% identity, 90% coverage: 23:259/263 of query aligns to 1:246/251 of 1btmA
P27876 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Bacillus subtilis (strain 168) (see paper)
49% identity, 90% coverage: 22:259/263 of query aligns to 1:247/253 of P27876
3uwvA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid (see paper)
46% identity, 91% coverage: 21:259/263 of query aligns to 2:251/255 of 3uwvA
3uwzA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
46% identity, 91% coverage: 21:259/263 of query aligns to 1:250/254 of 3uwzA
3uwwA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 3-phosphoglyceric acid (see paper)
46% identity, 91% coverage: 21:259/263 of query aligns to 1:250/254 of 3uwwA
3uwuA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-3-phosphate (see paper)
46% identity, 90% coverage: 22:259/263 of query aligns to 1:249/253 of 3uwuA
Q6GIL6 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Staphylococcus aureus (strain MRSA252) (see paper)
46% identity, 90% coverage: 22:259/263 of query aligns to 1:249/253 of Q6GIL6
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
45% identity, 92% coverage: 17:259/263 of query aligns to 396:649/654 of P36204
Sites not aligning to the query:
3uwzB Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
45% identity, 90% coverage: 22:259/263 of query aligns to 1:246/250 of 3uwzB
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
42% identity, 90% coverage: 23:260/263 of query aligns to 2:247/250 of 4y96A
P50921 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Moritella marina (Vibrio marinus) (see paper)
43% identity, 87% coverage: 22:251/263 of query aligns to 1:240/256 of P50921
1aw1A Triosephosphate isomerase of vibrio marinus complexed with 2- phosphoglycolate (see paper)
43% identity, 87% coverage: 23:251/263 of query aligns to 1:239/255 of 1aw1A
4mvaA 1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate. (see paper)
40% identity, 90% coverage: 22:259/263 of query aligns to 1:246/255 of 4mvaA
B1XB85 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Escherichia coli (strain K12 / DH10B) (see paper)
40% identity, 90% coverage: 22:259/263 of query aligns to 1:246/255 of B1XB85
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
42% identity, 91% coverage: 21:260/263 of query aligns to 2:249/252 of 6neeB
3taoA Structure of mycobacterium tuberculosis triosephosphate isomerase bound to phosphoglycolohydroxamate (see paper)
42% identity, 90% coverage: 23:258/263 of query aligns to 2:250/256 of 3taoA
P9WG43 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
42% identity, 90% coverage: 23:258/263 of query aligns to 3:251/261 of P9WG43
4y90A Crystal structure of triosephosphate isomerase from deinococcus radiodurans (see paper)
44% identity, 87% coverage: 24:251/263 of query aligns to 2:232/244 of 4y90A
>Synpcc7942_1261 Synpcc7942_1261 triosephosphate isomerase
LGEVRRHLKLVNGLARSEQSAVRRIIIAGNWKMYKTQAEALEFLQAFLPQLSETPESRKV
VLCAPFTTLSSLSKTLHGSRVRVGAQNIHWAKEGAFTGEISGAMLTEIGVRYVVVGHSER
RQYFGETDETVNQRLLAAQSFGLLPILCVGESKQQRDAGETEAVISRQLERGLVGADQTN
LVIAYEPIWAIGTGDTCAAEEANRVIGLIRSQLKDTDVPIQYGGSVKPENIDEIMAQPEI
DGALVGGASLEAESFARIVNYQS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory