Comparing Synpcc7942_1276 FitnessBrowser__SynE:Synpcc7942_1276 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
28% identity, 85% coverage: 38:258/260 of query aligns to 6:233/243 of 5eyfB
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
29% identity, 86% coverage: 38:260/260 of query aligns to 3:231/231 of 2v25A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
24% identity, 83% coverage: 44:258/260 of query aligns to 3:222/225 of 4zv2A
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
28% identity, 68% coverage: 35:211/260 of query aligns to 1:184/247 of 2yjpA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
26% identity, 83% coverage: 44:258/260 of query aligns to 3:224/226 of 4zv1A
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
39% identity, 37% coverage: 38:132/260 of query aligns to 3:94/229 of 6svfA
Sites not aligning to the query:
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
25% identity, 71% coverage: 41:225/260 of query aligns to 47:239/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
25% identity, 71% coverage: 41:225/260 of query aligns to 47:239/287 of 6h1uA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
25% identity, 71% coverage: 41:225/260 of query aligns to 48:240/288 of 6h2tA
7a99B Crystal structure of the phe57trp mutant of the arginine-bound form of domain 1 from tmargbp (see paper)
36% identity, 37% coverage: 38:132/260 of query aligns to 2:93/130 of 7a99B
Sites not aligning to the query:
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
28% identity, 62% coverage: 38:198/260 of query aligns to 4:173/240 of 4h5fA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
26% identity, 73% coverage: 38:228/260 of query aligns to 3:199/229 of 5t0wA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
24% identity, 79% coverage: 38:242/260 of query aligns to 7:217/251 of 1xt8B
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
28% identity, 62% coverage: 40:199/260 of query aligns to 12:177/239 of 4zefA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
27% identity, 66% coverage: 47:218/260 of query aligns to 8:183/228 of 2y7iA
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
25% identity, 75% coverage: 35:228/260 of query aligns to 5:216/324 of 4z9nB
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
24% identity, 79% coverage: 38:243/260 of query aligns to 1:215/237 of 4i62A
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
24% identity, 69% coverage: 49:228/260 of query aligns to 18:204/235 of 4g4pA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
30% identity, 42% coverage: 49:157/260 of query aligns to 30:143/260 of P02911
Sites not aligning to the query:
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
30% identity, 42% coverage: 49:157/260 of query aligns to 8:121/238 of 1lstA
Sites not aligning to the query:
>Synpcc7942_1276 FitnessBrowser__SynE:Synpcc7942_1276
MNKASRPTLLRRWLLLGTSVLASFFYGANTSGTIAADLETIKRRGYLIVGVQANVAPLSW
QDAQGQWQGFEVDLARSLAAELLGNSAAVRFEGLQSRDRLPALLADRVDLLIAQMTVTDA
RQRVAQFSRPYYRDRIGLLTRRGITQPQRVAVLQGSSAIPLLRWQAPELALVGVKSYAAA
QTALDRGQVDGIAADRLVLQQWQRQSDRYQLLPQQWGDFPLAIALPQGLQYRSLQIAIDR
LIQNWDADDKLRDIRKRWGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory