Comparing Synpcc7942_1305 FitnessBrowser__SynE:Synpcc7942_1305 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 51% coverage: 1:272/536 of query aligns to 1:286/330 of P0AAH4
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 49% coverage: 270:534/536 of query aligns to 1:249/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 49% coverage: 270:534/536 of query aligns to 2:250/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 49% coverage: 270:534/536 of query aligns to 2:250/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 49% coverage: 270:534/536 of query aligns to 2:250/344 of 3tuiC
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
41% identity, 43% coverage: 298:529/536 of query aligns to 17:247/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
41% identity, 43% coverage: 298:529/536 of query aligns to 17:247/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
41% identity, 43% coverage: 298:529/536 of query aligns to 17:247/250 of 7z16I
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
42% identity, 45% coverage: 287:526/536 of query aligns to 8:236/241 of 4u00A
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
37% identity, 45% coverage: 290:530/536 of query aligns to 13:247/375 of 2d62A
1g291 Malk (see paper)
37% identity, 45% coverage: 290:530/536 of query aligns to 10:244/372 of 1g291
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
37% identity, 44% coverage: 297:533/536 of query aligns to 20:261/310 of 4fwiB
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
37% identity, 43% coverage: 297:529/536 of query aligns to 21:258/326 of Q8RDH4
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
35% identity, 49% coverage: 271:534/536 of query aligns to 7:236/353 of 1vciA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 51% coverage: 257:529/536 of query aligns to 7:251/378 of P69874
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 49% coverage: 271:531/536 of query aligns to 3:268/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 49% coverage: 271:531/536 of query aligns to 3:268/382 of 7aheC
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
38% identity, 42% coverage: 282:504/536 of query aligns to 7:215/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
38% identity, 42% coverage: 282:504/536 of query aligns to 7:215/219 of 8w6iD
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
37% identity, 42% coverage: 282:504/536 of query aligns to 7:215/218 of 8hd0A
>Synpcc7942_1305 FitnessBrowser__SynE:Synpcc7942_1305
MTLLSIDQLSVTYPGSEQPALQQLSLELAAGERLGLVGESGCGKSTLGRAILRLLPPGSH
QQGDIRLAGQALGQLQGRSLQRFRGGQVGLVFQDPMTRLDPLQTIGDHLLETLQVHRPHL
SRRQAKQQALSWLERVRIPANRWSQYPHQFSGGMRQRVAIALALLLQPRLVVADEPTTSL
DVTVAAEILQELTRLCSEENTSLLLISHDLPMVAAYCDRIAVLYQGQLVETGPTTAVLTR
PQHPYTQTLLQSARAAIASSPSTLPATTPLLQLENVTQHFRVAQSWLQGWRGGGEIVRAV
DGLSLEVWPGETLGLIGESGCGKSTLLRTILQLLRPSQGKVLFQGQDLTQLPDRRLRSLR
RELQLIFQDPAACLNPRLTIGDAIADPLKIQGLARGAAAKQQVLAILEQVGLTPAPTWID
RYPHQLSGGQQQRVAIARALITRPKLVLCDEPVSMLDATVQAQVLALMQELKQQLNLTYL
FVTHDLRVAREFCDRVAVLQRGKIVEIGPAAQVLTQPEHPYTRSLLASLPELPIAI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory