Comparing Synpcc7942_1317 FitnessBrowser__SynE:Synpcc7942_1317 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 87% coverage: 1:213/245 of query aligns to 1:217/240 of 4ymuJ
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
26% identity, 95% coverage: 1:232/245 of query aligns to 2:237/240 of 6mjpA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 84% coverage: 1:206/245 of query aligns to 2:210/241 of 4u00A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
28% identity, 93% coverage: 2:228/245 of query aligns to 3:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
28% identity, 93% coverage: 2:228/245 of query aligns to 3:233/238 of 6s8gA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
28% identity, 93% coverage: 2:228/245 of query aligns to 3:233/233 of 6b8bA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
28% identity, 93% coverage: 2:228/245 of query aligns to 3:233/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
28% identity, 93% coverage: 2:228/245 of query aligns to 3:233/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
28% identity, 93% coverage: 2:228/245 of query aligns to 3:233/234 of 4p31A
6mbnA Lptb e163q in complex with atp (see paper)
27% identity, 93% coverage: 2:228/245 of query aligns to 4:234/241 of 6mbnA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 88% coverage: 10:224/245 of query aligns to 26:242/378 of P69874
Sites not aligning to the query:
5w81A Phosphorylated, atp-bound structure of zebrafish cystic fibrosis transmembrane conductance regulator (cftr) (see paper)
35% identity, 84% coverage: 2:206/245 of query aligns to 393:588/1173 of 5w81A
Sites not aligning to the query:
3fvqB Crystal structure of the nucleotide binding domain fbpc complexed with atp (see paper)
35% identity, 84% coverage: 2:207/245 of query aligns to 4:213/350 of 3fvqB
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
33% identity, 78% coverage: 1:191/245 of query aligns to 3:202/226 of 5xu1B
Q1LX78 Cystic fibrosis transmembrane conductance regulator; ATP-binding cassette sub-family C member 7; Channel conductance-controlling ATPase; cAMP-dependent chloride channel; EC 5.6.1.6 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
36% identity, 78% coverage: 16:206/245 of query aligns to 439:619/1485 of Q1LX78
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 84% coverage: 1:206/245 of query aligns to 3:212/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 84% coverage: 1:206/245 of query aligns to 3:212/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 84% coverage: 1:206/245 of query aligns to 3:212/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 84% coverage: 1:206/245 of query aligns to 3:212/242 of 2oljA
4hluA Structure of the ecfa-a' heterodimer bound to adp (see paper)
29% identity, 80% coverage: 13:207/245 of query aligns to 19:213/265 of 4hluA
Sites not aligning to the query:
>Synpcc7942_1317 FitnessBrowser__SynE:Synpcc7942_1317
MLEIQHLSVCYRQQRVLEDICLQVQAGEQLALIGPNGAGKSTLVRAILGLLTPYAGEVRW
RGRPLRRGQRSIAYVPQRSQIDWQYPITVETVVRLGAEVRSWWGRSPQTGSRIAAALEQV
QLTELRHRPLAELSGGQQQRVFLARAIAQGADLLLLDEPFTGIDHPTERLMQNLFQQFAQ
QGKTLIVCSHEWGDALQRYDRLILLNRRIICHDIPDRALTPQNLQQTFGARQPDAPPDRQ
WGFAC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory