SitesBLAST
Comparing Synpcc7942_1335 FitnessBrowser__SynE:Synpcc7942_1335 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5e25A Crystal structure of branched-chain aminotransferase from thermophilic archaea geoglobus acetivorans complexed with alpha-ketoglutarate (see paper)
29% identity, 97% coverage: 4:260/264 of query aligns to 6:283/290 of 5e25A
- active site: F33 (= F31), G35 (≠ T33), K151 (= K142), E184 (= E175), L207 (= L199)
- binding 2-oxoglutaric acid: Y88 (≠ A84), K151 (= K142), T247 (≠ N233), A248 (≠ S234)
- binding pyridoxal-5'-phosphate: R52 (= R50), K151 (= K142), Y155 (= Y146), E184 (= E175), G187 (≠ A178), D188 (≠ A179), L207 (= L199), G209 (= G201), I210 (= I202), T211 (≠ V203), G246 (≠ S232), T247 (≠ N233)
5mr0D Thermophilic archaeal branched-chain amino acid transaminases from geoglobus acetivorans and archaeoglobus fulgidus: biochemical and structural characterisation (see paper)
28% identity, 93% coverage: 4:248/264 of query aligns to 5:261/290 of 5mr0D
- active site: F32 (= F31), G34 (≠ T33), K150 (= K142), E183 (= E175), L206 (= L199)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: R51 (= R50), G100 (= G97), L101 (= L98), K150 (= K142), Y154 (= Y146), E183 (= E175), G186 (≠ A178), D187 (≠ A179), L206 (= L199), I209 (= I202), T210 (≠ V203), G245 (≠ S232), T246 (≠ N233)
P19938 D-alanine aminotransferase; D-amino acid aminotransferase; D-amino acid transaminase; DAAT; D-aspartate aminotransferase; EC 2.6.1.21 from Bacillus sp. (strain YM-1) (see 5 papers)
28% identity, 94% coverage: 2:248/264 of query aligns to 1:257/283 of P19938
- M1 (≠ I2) modified: Initiator methionine, Removed
- Y32 (≠ F31) binding
- R51 (= R50) binding
- R99 (= R96) binding
- H101 (≠ L98) binding
- K146 (= K142) active site, Proton acceptor; modified: N6-(pyridoxal phosphate)lysine
- E178 (= E175) binding ; mutation to K: Loss of transaminase activity and small gain in racemase activity.
- L202 (= L199) mutation to A: Inactivates enzyme.
3daaA Crystallographic structure of d-amino acid aminotransferase inactivated by pyridoxyl-d-alanine (see paper)
28% identity, 93% coverage: 3:248/264 of query aligns to 1:256/277 of 3daaA
- active site: Y31 (≠ F31), V33 (≠ T33), K145 (= K142), E177 (= E175), L201 (= L199)
- binding n-(5'-phosphopyridoxyl)-d-alanine: Y31 (≠ F31), R50 (= R50), K145 (= K142), E177 (= E175), S180 (≠ A178), S181 (≠ A179), L201 (= L199), G203 (= G201), I204 (= I202), T205 (≠ V203), S240 (≠ N233), T241 (≠ S234)
2daaA Crystallographic structure of d-amino acid aminotransferase inactivated by d-cycloserine
28% identity, 93% coverage: 3:248/264 of query aligns to 1:256/277 of 2daaA
- active site: Y31 (≠ F31), V33 (≠ T33), K145 (= K142), E177 (= E175), L201 (= L199)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: Y31 (≠ F31), V33 (≠ T33), R50 (= R50), R98 (= R96), H100 (≠ L98), K145 (= K142), E177 (= E175), S180 (≠ A178), S181 (≠ A179), N182 (= N180), L201 (= L199), G203 (= G201), I204 (= I202), T205 (≠ V203), T241 (≠ S234)
1daaA Crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate (see paper)
28% identity, 93% coverage: 3:248/264 of query aligns to 1:256/277 of 1daaA
- active site: Y31 (≠ F31), V33 (≠ T33), K145 (= K142), E177 (= E175), L201 (= L199)
- binding pyridoxal-5'-phosphate: R50 (= R50), K145 (= K142), E177 (= E175), S180 (≠ A178), S181 (≠ A179), L201 (= L199), G203 (= G201), I204 (= I202), T205 (≠ V203), S240 (≠ N233), T241 (≠ S234)
3lqsA Complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta) (see paper)
28% identity, 93% coverage: 3:248/264 of query aligns to 1:256/280 of 3lqsA
- active site: Y31 (≠ F31), V33 (≠ T33), K145 (= K142), E177 (= E175), L201 (= L199)
- binding 4-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]thiophene-2-carboxylic acid: V33 (≠ T33), R50 (= R50), E177 (= E175), S180 (≠ A178), S181 (≠ A179), N182 (= N180), L201 (= L199), G203 (= G201), I204 (= I202), T205 (≠ V203), S240 (≠ N233), T241 (≠ S234), T242 (≠ L235)
1a0gB L201a mutant of d-amino acid aminotransferase complexed with pyridoxamine-5'-phosphate (see paper)
28% identity, 93% coverage: 3:248/264 of query aligns to 1:256/282 of 1a0gB
- active site: Y31 (≠ F31), V33 (≠ T33), K145 (= K142), E177 (= E175), A201 (≠ L199)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: R50 (= R50), K145 (= K142), E177 (= E175), S180 (≠ A178), S181 (≠ A179), G203 (= G201), I204 (= I202), T205 (≠ V203), S240 (≠ N233), T241 (≠ S234)
7p3tB Transaminase of gamma-proteobacterium (see paper)
30% identity, 84% coverage: 2:223/264 of query aligns to 5:230/299 of 7p3tB
- binding pyridoxal-5'-phosphate: R53 (= R50), K153 (= K142), R157 (≠ Y146), E186 (= E175), S187 (≠ A176), A188 (= A177), A189 (= A178), S190 (≠ A179), G210 (= G201), I211 (= I202), T212 (≠ V203)
Sites not aligning to the query:
1i2lA Deoxychorismate lyase from escherichia coli with inhibitor
31% identity, 83% coverage: 16:235/264 of query aligns to 11:238/269 of 1i2lA
- active site: F26 (= F31), T28 (= T33), I139 (≠ F141), K140 (= K142), E173 (= E175), V197 (≠ L199)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: R45 (= R50), K140 (= K142), E173 (= E175), C175 (≠ A177), A176 (= A178), A177 (= A179), N178 (= N180), V197 (≠ L199), G199 (= G201), I200 (= I202), M201 (≠ V203), N236 (= N233), A237 (≠ S234)
1i2kA Aminodeoxychorismate lyase from escherichia coli
31% identity, 83% coverage: 16:235/264 of query aligns to 11:238/269 of 1i2kA
- active site: F26 (= F31), T28 (= T33), I139 (≠ F141), K140 (= K142), E173 (= E175), V197 (≠ L199)
- binding pyridoxal-5'-phosphate: R45 (= R50), K140 (= K142), E173 (= E175), A176 (= A178), A177 (= A179), V197 (≠ L199), G199 (= G201), I200 (= I202), M201 (≠ V203), N236 (= N233), A237 (≠ S234)
2y4rA Crystal structure of 4-amino-4-deoxychorismate lyase from pseudomonas aeruginosa (see paper)
34% identity, 73% coverage: 17:208/264 of query aligns to 12:205/270 of 2y4rA
Sites not aligning to the query:
7dbeB Structure of a novel transaminase
27% identity, 96% coverage: 7:259/264 of query aligns to 45:316/332 of 7dbeB
- binding pyridoxal-5'-phosphate: R88 (= R50), K190 (= K142), E223 (= E175), G226 (≠ A178), F227 (≠ A179), N228 (= N180), L245 (= L199), G247 (= G201), I248 (= I202), T249 (≠ V203), T285 (≠ N233)
6xwbA Crystal structure of an r-selective transaminase from thermomyces stellatus. (see paper)
26% identity, 94% coverage: 2:248/264 of query aligns to 29:288/319 of 6xwbA
- binding pyridoxal-5'-phosphate: R77 (= R50), K178 (= K142), F185 (≠ N149), E211 (= E175), G214 (≠ A178), F215 (≠ A179), N216 (= N180), L233 (= L199), G235 (= G201), V236 (≠ I202), T237 (≠ V203), T273 (≠ N233)
8pnyA Crystal structure of d-amino acid aminotransferase from blastococcus saxobsidens complexed with phenylhydrazine and in its apo form (see paper)
30% identity, 77% coverage: 10:212/264 of query aligns to 15:226/278 of 8pnyA
- binding [6-methyl-5-oxidanyl-4-[(2-phenylhydrazinyl)methyl]pyridin-3-yl]methyl dihydrogen phosphate: F36 (= F31), S38 (≠ T33), R55 (= R50), K152 (= K142), Y156 (= Y146), E185 (= E175), G186 (≠ A176), P187 (≠ A177), T188 (≠ A178), S189 (≠ A179), T190 (≠ N180), L209 (= L199), T212 (≠ I202), T213 (≠ V203)
Sites not aligning to the query:
8pnwA Crystal structure of d-amino acid aminotransferase from blastococcus saxobsidens in holo form with plp (see paper)
30% identity, 77% coverage: 10:212/264 of query aligns to 15:226/278 of 8pnwA
Sites not aligning to the query:
7z79B Crystal structure of aminotransferase-like protein from variovorax paradoxus
27% identity, 93% coverage: 4:248/264 of query aligns to 19:277/306 of 7z79B
- binding pyridoxal-5'-phosphate: W46 (≠ F31), R65 (= R50), N166 (≠ K142), S202 (≠ A178), T203 (≠ A179), F222 (≠ L199), G224 (= G201), I225 (= I202), T226 (≠ V203), G261 (≠ S232), T262 (≠ N233)
4cmfA The (r)-selective transaminase from nectria haematococca with inhibitor bound (see paper)
29% identity, 78% coverage: 2:208/264 of query aligns to 29:243/322 of 4cmfA
- active site: Y58 (≠ F31), V60 (≠ T33), K179 (= K142), E212 (= E175), L234 (= L199)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: V60 (≠ T33), R77 (= R50), F113 (≠ A84), K179 (= K142), E212 (= E175), G215 (≠ A178), F216 (≠ A179), N217 (= N180), L234 (= L199), G236 (= G201), I237 (= I202), T238 (≠ V203)
Sites not aligning to the query:
4cmdA The (r)-selective transaminase from nectria haematococca (see paper)
29% identity, 78% coverage: 2:208/264 of query aligns to 29:243/322 of 4cmdA
- active site: Y58 (≠ F31), V60 (≠ T33), K179 (= K142), E212 (= E175), L234 (= L199)
- binding pyridoxal-5'-phosphate: R77 (= R50), K179 (= K142), E212 (= E175), G215 (≠ A178), F216 (≠ A179), L234 (= L199), G236 (= G201), I237 (= I202), T238 (≠ V203)
Sites not aligning to the query:
5fr9A Structure of transaminase ata-117 arrmut11 from arthrobacter sp. Knk168 inhibited with 1-(4-bromophenyl)-2-fluoroethylamine (see paper)
29% identity, 77% coverage: 7:208/264 of query aligns to 32:241/319 of 5fr9A
- active site: Y56 (≠ F31), K177 (= K142), E210 (= E175), L232 (= L199)
- binding [4-[3-(4-bromophenyl)-3-oxidanylidene-propyl]-6-methyl-5-oxidanyl-pyridin-3-yl]methyl phosphate: R75 (= R50), K177 (= K142), E210 (= E175), G213 (≠ A178), F214 (≠ A179), L232 (= L199), G234 (= G201), I235 (= I202), T236 (≠ V203)
Sites not aligning to the query:
Query Sequence
>Synpcc7942_1335 FitnessBrowser__SynE:Synpcc7942_1335
MIGYCNGQWIPTEDLTIAVTDRGFSLGDGLFETLLVWQGKVRLAEQHWQRLTSSAQQLRI
PLPPNANIDLLQATVDHNELETGALRVTLTRGCGQRGLQSPEPLQPLLVIVPSLSQPQFQ
PLRLITAQTVRRCPESILSRFKTLSYLENVLARQEAEQRQADEALLLTPSDRLSEAAAAN
IFFRLNDDWWTPPLSDGALPGIVRQRLLATGWAKETSIAWSQRNQVEAIALSNSLSFRPV
SHWDGRALWTDLEDWRSRFEALQL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory