SitesBLAST
Comparing Synpcc7942_1367 FitnessBrowser__SynE:Synpcc7942_1367 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6mcwA Crystal structure of the p450 domain of the cyp51-ferredoxin fusion protein from methylococcus capsulatus, complex with the detergent anapoe-x-114 (see paper)
24% identity, 90% coverage: 3:413/455 of query aligns to 7:414/446 of 6mcwA
- binding protoporphyrin ix containing fe: A254 (≠ L260), G255 (= G261), T258 (= T264), P318 (≠ A320), L319 (= L321), R324 (= R326), A383 (≠ P382), F384 (= F383), H389 (≠ R388), C391 (= C390), S392 (≠ I391), G393 (= G392), F396 (≠ L395), A397 (≠ S396)
- binding 23-[4-(2,4,4-trimethylpentan-2-yl)phenoxy]-3,6,9,12,15,18,21-heptaoxatricosan-1-ol: Y76 (≠ A74), F89 (≠ I87), E175 (≠ D169), M176 (≠ Q170), I178 (≠ L172), Q179 (≠ E173), A254 (≠ L260), H257 (≠ E263)
Sites not aligning to the query:
7snmA Lanosterol-bound p450 domain of the cyp51-ferredoxin fusion protein from methylococcus capsulatus (see paper)
24% identity, 90% coverage: 3:413/455 of query aligns to 5:412/443 of 7snmA
- binding protoporphyrin ix containing fe: Q70 (≠ L70), Y74 (≠ A74), L98 (≠ R98), A252 (≠ L260), T256 (= T264), P316 (≠ A320), L317 (= L321), L320 (≠ Q324), R322 (= R326), A381 (≠ P382), F382 (= F383), H387 (≠ R388), C389 (= C390), G391 (= G392)
- binding lanosterol: Y74 (≠ A74), L98 (≠ R98), L101 (= L101), Y181 (≠ F184), T249 (≠ L257), A252 (≠ L260), L319 (≠ A323)
2ve3A Retinoic acid bound cyanobacterial cyp120a1 (see paper)
28% identity, 90% coverage: 2:410/455 of query aligns to 5:403/435 of 2ve3A
- active site: A246 (≠ L260), E249 (= E263), T250 (= T264), L251 (≠ T265), F376 (= F383), C383 (= C390), E392 (= E399)
- binding protoporphyrin ix containing fe: L85 (= L86), H93 (= H94), R97 (= R98), F151 (≠ V152), L242 (≠ T256), L243 (= L257), A246 (≠ L260), G247 (= G261), T250 (= T264), P309 (≠ A320), V310 (≠ L321), R315 (= R326), Y336 (≠ P347), P375 (= P382), F376 (= F383), R381 (= R388), C383 (= C390), A389 (≠ S396)
- binding retinoic acid: F21 (≠ I18), W72 (≠ R72), F174 (≠ E173), F245 (≠ L259), G311 (≠ I322), G312 (≠ A323), Q337 (≠ C348)
P20817 Cytochrome P450 4A14; CYPIVA14; Cytochrome P450-LA-omega 3; Lauric acid omega-hydroxylase; Long-chain fatty acid omega-monooxygenase; EC 1.14.14.80 from Rattus norvegicus (Rat) (see 4 papers)
29% identity, 83% coverage: 49:425/455 of query aligns to 94:490/507 of P20817
- A113 (≠ E69) mutation to P: 70-fold increase of the binding constant for lauric acid associated with higher catalytic activity.
- SG-I 114:116 (≠ LGRI 70:73) mutation Missing: Higher kcat for hydroxylation of lauric acid. 2-fold increase of omega/(omega-1) hydroxylation ratio for lauric and myristic acids; when associated with S-119.
- F119 (≠ V76) mutation to S: 7-fold increase of the binding constant for lauric acid associated with higher catalytic activity. 2-fold increase of omega/omega-1 hydroxylation ratio for lauric and myristic acids; when associated with S114_I116del.
- E318 (≠ L260) binding covalent; mutation to A: Loss of covalent heme binding.; mutation to D: Significant reduction in covalent heme binding.; mutation to Q: Significant reduction in covalent heme binding.
- C454 (= C390) binding axial binding residue
Sites not aligning to the query:
- 1:4 modified: propeptide, Removed in mature form
- 63 D→N: Has no significant effect on the catalytic activity toward lauric and myristic acids.
- 91 K→T: Impairs substrate binding.
Q9K498 Bifunctional albaflavenone monooxygenase/terpene synthase; Cytochrome P450 170A1; CYP170A1; EC 1.14.15.39; EC 4.2.3.47 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see paper)
27% identity, 92% coverage: 16:432/455 of query aligns to 39:451/461 of Q9K498
- DDNGD 253:257 (≠ DRDGN 239:243) mutation to AANGA: Loss of farnesene synthase activity, whereas the P450 monooxygenase activity is retained.
- C410 (= C390) binding axial binding residue
7jj1A Crystal structure of the sterol 14alpha-demethylase-ferredoxin (cyp51- fx) heme domain and architectural comparison to the whole fusion protein
24% identity, 90% coverage: 3:413/455 of query aligns to 5:409/440 of 7jj1A
- binding cetyl-trimethyl-ammonium: F81 (≠ V81), E173 (≠ D169), I176 (≠ L172), Q177 (≠ E173), A245 (≠ T256), A249 (≠ L260)
- binding protoporphyrin ix containing fe: L98 (≠ R98), T246 (≠ L257), G250 (= G261), T253 (= T264), P313 (≠ A320), L314 (= L321), L317 (≠ Q324), R319 (= R326), A378 (≠ P382), F379 (= F383), G380 (= G384), H384 (≠ R388), C386 (= C390), S387 (≠ I391), G388 (= G392), A392 (≠ S396)
P20816 Cytochrome P450 4A2; CYPIVA2; Cytochrome P-450 K-2; Cytochrome P450 K-5; Cytochrome P450-LA-omega 2; Lauric acid omega-hydroxylase; Long-chain fatty acid omega-monooxygenase; EC 1.14.14.80 from Rattus norvegicus (Rat) (see 4 papers)
29% identity, 75% coverage: 79:421/455 of query aligns to 119:483/504 of P20816
- E315 (≠ L260) binding covalent
- C451 (= C390) binding axial binding residue
Sites not aligning to the query:
- 1:4 modified: propeptide
- 116 S→F: 2-fold decrease of omega/omega-1 hydroxylation ratio for lauric acid.
7rkwA Naegleria fowleri cyp51(nfcyp51) complex with (s)-1-(4-fluorophenyl)- 2-(1h-imidazol-1-yl)ethyl 3,5-dichlorobenzoate (see paper)
24% identity, 93% coverage: 20:441/455 of query aligns to 22:446/450 of 7rkwA
- binding (1S)-1-(4-fluorophenyl)-2-(1H-imidazol-1-yl)ethyl 3,5-dichlorobenzoate: F75 (≠ V76), M76 (≠ F77), F80 (≠ V81), V85 (≠ L86), Y86 (≠ I87), A255 (≠ T256), G256 (≠ L257), F258 (≠ L259), A259 (≠ L260), T263 (= T264), L324 (= L321)
- binding protoporphyrin ix containing fe: A259 (≠ L260), G260 (= G261), T263 (= T264), P323 (≠ A320), L324 (= L321), R329 (= R326), P388 (= P382), F389 (= F383), H394 (≠ R388), C396 (= C390), I397 (= I391), G398 (= G392), A402 (≠ S396)
6ay4A Naegleria fowleri cyp51-fluconazole complex (see paper)
24% identity, 93% coverage: 20:441/455 of query aligns to 22:446/450 of 6ay4A
- binding protoporphyrin ix containing fe: A259 (≠ L260), G260 (= G261), T263 (= T264), P323 (≠ A320), L324 (= L321), R329 (= R326), P388 (= P382), F389 (= F383), G390 (= G384), H394 (≠ R388), C396 (= C390), I397 (= I391)
- binding 2-(2,4-difluorophenyl)-1,3-di(1h-1,2,4-triazol-1-yl)propan-2-ol: Y73 (≠ A74), M76 (≠ F77), F80 (≠ V81), Y86 (≠ I87), A255 (≠ T256), F258 (≠ L259), A259 (≠ L260), L324 (= L321)
5tl8A Naegleria fowleri cyp51-posaconazole complex
24% identity, 93% coverage: 20:441/455 of query aligns to 22:446/450 of 5tl8A
- binding calcium ion: L50 (≠ V51), V350 (≠ P347), S351 (≠ C348)
- binding protoporphyrin ix containing fe: Y73 (≠ A74), Y86 (≠ I87), A259 (≠ L260), T263 (= T264), P323 (≠ A320), L324 (= L321), R329 (= R326), P388 (= P382), F389 (= F383), H394 (≠ R388), C396 (= C390), I397 (= I391), G398 (= G392), F401 (≠ L395), A402 (≠ S396)
- binding posaconazole: Y73 (≠ A74), F80 (≠ V81), Y86 (≠ I87), P179 (≠ S181), L180 (= L182), F182 (= F184), A255 (≠ T256), F258 (≠ L259), A259 (≠ L260), T263 (= T264), L324 (= L321), M326 (≠ A323), Y430 (≠ R425), T431 (≠ R426), L433 (≠ I428)
Sites not aligning to the query:
7rkrA Naegleria fowleri cyp51 (nfcyp51) complex with (s)-1-(4-fluorophenyl)- 2-(1h-imidazol-1-yl)ethyl 3-(trifluoromethyl)benzoate (see paper)
24% identity, 93% coverage: 20:441/455 of query aligns to 22:446/451 of 7rkrA
- binding calcium ion: L50 (≠ V51), N51 (≠ S52), S351 (≠ C348)
- binding protoporphyrin ix containing fe: Y86 (≠ I87), A259 (≠ L260), T263 (= T264), L324 (= L321), R329 (= R326), P388 (= P382), F389 (= F383), H394 (≠ R388), C396 (= C390), I397 (= I391), G398 (= G392), A402 (≠ S396)
- binding (1S)-1-(4-fluorophenyl)-2-(1H-imidazol-1-yl)ethyl 3-(trifluoromethyl)benzoate: Y73 (≠ A74), F75 (≠ V76), M76 (≠ F77), V85 (≠ L86), Y86 (≠ I87), A255 (≠ T256), G256 (≠ L257), F258 (≠ L259), A259 (≠ L260), L324 (= L321)
Sites not aligning to the query:
7rktA Naegleria fowleri cyp51 (nfcyp51) complex with (s)-1-(2,4- dichlorophenyl)-2-(1h-imidazol-1-yl)ethyl 3-(trifluoromethyl)benzoate (see paper)
24% identity, 93% coverage: 20:441/455 of query aligns to 22:446/452 of 7rktA
- binding (1S)-1-(2,4-dichlorophenyl)-2-(1H-imidazol-1-yl)ethyl 3-(trifluoromethyl)benzoate: F75 (≠ V76), M76 (≠ F77), V85 (≠ L86), Y86 (≠ I87), A255 (≠ T256), G256 (≠ L257), F258 (≠ L259), A259 (≠ L260), L324 (= L321)
- binding protoporphyrin ix containing fe: A259 (≠ L260), T263 (= T264), L324 (= L321), I327 (≠ Q324), R329 (= R326), P388 (= P382), F389 (= F383), H394 (≠ R388), C396 (= C390), G398 (= G392)
7rtqA Sterol 14alpha demethylase (cyp51) from naegleria fowleri in complex with an inhibitor r)-n-(1-(3,4'-difluorobiphenyl-4-yl)-2-(1h- imidazol-1-yl)ethyl)-4-(5-phenyl-1,3,4-oxadiazol-2-yl)benzamide (see paper)
24% identity, 93% coverage: 20:441/455 of query aligns to 22:446/449 of 7rtqA
- binding N-[(1R)-2-(1H-imidazol-1-yl)-1-(3,4',5-trifluoro[1,1'-biphenyl]-4-yl)ethyl]-4-(5-phenyl-1,3,4-oxadiazol-2-yl)benzamide: Y73 (≠ A74), V85 (≠ L86), Y86 (≠ I87), Q97 (= Q97), P179 (≠ S181), F182 (= F184), F183 (= F185), A255 (≠ T256), A259 (≠ L260), T263 (= T264), L324 (= L321), M326 (≠ A323), M328 (≠ P325), L433 (≠ I428)
- binding protoporphyrin ix containing fe: M95 (≠ R95), A259 (≠ L260), T263 (= T264), L324 (= L321), I327 (≠ Q324), R329 (= R326), P388 (= P382), F389 (= F383), H394 (≠ R388), C396 (= C390), G398 (= G392), A402 (≠ S396)
6aycA Naegleria fowleri cyp51-itraconazole complex (see paper)
24% identity, 93% coverage: 20:441/455 of query aligns to 22:446/449 of 6aycA
- active site: T263 (= T264), F389 (= F383), C396 (= C390)
- binding 2-[(2R)-butan-2-yl]-4-{4-[4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-1,2,4-triazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazin-1-yl]phenyl}-2,4-dihydro-3H-1,2,4-triazol-3-one: Y73 (≠ A74), F75 (≠ V76), F80 (≠ V81), Y86 (≠ I87), P179 (≠ S181), F182 (= F184), A255 (≠ T256), F258 (≠ L259), A259 (≠ L260), T263 (= T264), L324 (= L321), Y430 (≠ R425)
- binding protoporphyrin ix containing fe: Y73 (≠ A74), Y86 (≠ I87), A259 (≠ L260), G260 (= G261), T263 (= T264), P323 (≠ A320), L324 (= L321), R329 (= R326), P388 (= P382), F389 (= F383), H394 (≠ R388), C396 (= C390), I397 (= I391), G398 (= G392)
Sites not aligning to the query:
6aybA Naegleria fowleri cyp51-ketoconazole complex (see paper)
24% identity, 93% coverage: 20:441/455 of query aligns to 22:446/449 of 6aybA
- binding calcium ion: L50 (≠ V51), N51 (≠ S52), V350 (≠ P347), S351 (≠ C348)
- binding protoporphyrin ix containing fe: Y73 (≠ A74), Y86 (≠ I87), A259 (≠ L260), T263 (= T264), L324 (= L321), I327 (≠ Q324), R329 (= R326), P388 (= P382), F389 (= F383), H394 (≠ R388), C396 (= C390), I397 (= I391), G398 (= G392)
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: Y73 (≠ A74), F75 (≠ V76), F80 (≠ V81), Y86 (≠ I87), P179 (≠ S181), F183 (= F185), A255 (≠ T256), F258 (≠ L259), A259 (≠ L260), T263 (= T264), L324 (= L321), M326 (≠ A323)
6ay6A Naegleria fowleri cyp51-voriconazole complex (see paper)
24% identity, 93% coverage: 20:441/455 of query aligns to 22:446/449 of 6ay6A
- binding protoporphyrin ix containing fe: Y86 (≠ I87), A259 (≠ L260), G260 (= G261), T263 (= T264), S264 (≠ T265), L324 (= L321), I327 (≠ Q324), R329 (= R326), P388 (= P382), F389 (= F383), G390 (= G384), H394 (≠ R388), C396 (= C390), I397 (= I391), G398 (= G392)
- binding Voriconazole: Y73 (≠ A74), F80 (≠ V81), Y86 (≠ I87), A255 (≠ T256), F258 (≠ L259), A259 (≠ L260), T263 (= T264), L324 (= L321)
2vkuA 4,4'-dihydroxybenzophenone mimics sterol substrate in the binding site of sterol 14alpha-demethylase (cyp51) in the x-ray structure of the complex (see paper)
25% identity, 91% coverage: 5:420/455 of query aligns to 7:418/444 of 2vkuA
- active site: T255 (= T264), S256 (≠ T265), F382 (= F383), C389 (= C390)
- binding bis(4-hydroxyphenyl)methanone: H11 (≠ L9), Y71 (≠ A74), M74 (≠ F77), F78 (≠ V81), R91 (≠ Q96), M94 (≠ Q99), L174 (= L179), P182 (= P198), L224 (= L234), M248 (≠ L257), F250 (≠ L259), H254 (≠ E263), E303 (≠ D307), K307 (≠ R311), I318 (≠ A323), F382 (= F383), R388 (≠ S389), I396 (≠ L397)
- binding protoporphyrin ix containing fe: Y71 (≠ A74), R91 (≠ Q96), A251 (≠ L260), G252 (= G261), T255 (= T264), P315 (≠ A320), L316 (= L321), L319 (≠ Q324), R321 (= R326), P381 (= P382), F382 (= F383), C389 (= C390), V390 (≠ I391), A395 (≠ S396)
Sites not aligning to the query:
1ea1A Cytochrome p450 14 alpha-sterol demethylase (cyp51) from mycobacterium tuberculosis in complex with fluconazole (see paper)
25% identity, 91% coverage: 5:420/455 of query aligns to 10:421/447 of 1ea1A
- active site: T258 (= T264), S259 (≠ T265), F385 (= F383), C392 (= C390)
- binding protoporphyrin ix containing fe: Q70 (≠ L70), Y74 (≠ A74), R93 (= R95), R94 (≠ Q96), A254 (≠ L260), T258 (= T264), P318 (≠ A320), L322 (≠ Q324), R324 (= R326), P384 (= P382), F385 (= F383), H390 (≠ R388), C392 (= C390), V393 (≠ I391), G394 (= G392), A398 (≠ S396)
- binding 2-(2,4-difluorophenyl)-1,3-di(1h-1,2,4-triazol-1-yl)propan-2-ol: Y74 (≠ A74), F76 (≠ V76), R94 (≠ Q96), F253 (≠ L259), A254 (≠ L260), L319 (= L321)
1e9xA Cytochrome p450 14 alpha-sterol demethylase (cyp51) from mycobacterium tuberculosis in complex with 4-phenylimidazole (see paper)
25% identity, 91% coverage: 5:420/455 of query aligns to 12:423/449 of 1e9xA
- active site: T260 (= T264), S261 (≠ T265), F387 (= F383), C394 (= C390)
- binding protoporphyrin ix containing fe: Q72 (≠ L70), Y76 (≠ A74), K97 (≠ Q97), H101 (≠ L101), L105 (= L105), A256 (≠ L260), G257 (= G261), T260 (= T264), P320 (≠ A320), L324 (≠ Q324), R326 (= R326), P386 (= P382), F387 (= F383), G388 (= G384), H392 (≠ R388), C394 (= C390), V395 (≠ I391), G396 (= G392), A400 (≠ S396)
- binding 4-phenyl-1h-imidazole: Y76 (≠ A74), M79 (≠ F77), A256 (≠ L260), H259 (≠ E263), L321 (= L321)
P9WPP9 Sterol 14alpha-demethylase; CYPLI; Cytochrome P450 51; Cytochrome P450-14DM; Cytochrome P450-LIA1; Sterol 14-alpha demethylase; EC 1.14.15.36 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 5 papers)
25% identity, 91% coverage: 5:420/455 of query aligns to 12:423/451 of P9WPP9
- Q72 (≠ L70) binding
- Y76 (≠ A74) binding
- K97 (≠ Q97) binding
- R326 (= R326) binding
- H392 (≠ R388) binding
- C394 (= C390) binding axial binding residue
Query Sequence
>Synpcc7942_1367 FitnessBrowser__SynE:Synpcc7942_1367
MLPPGPSQLALLQTLRIITQPVSFLLSCADRYGDWFTLRVLGPQSPPVVFVSDPEAILAI
FSSLADQLELGRIADVFRPLVGNESLIMQNGDRHRQQRQLLMPALQGERLFDYTPAMTAI
TQAAIAQWPLGQPLDLRRQMSQISLAVILQVVFGLTPGPRYRDLYQRLDQLLEAITDPLY
SLQFFWPALQQDWGNWSPWGRFCRQREAIDALITAEIQEGRQSQQPRQDVLELLLAARDR
DGNPLSDQELRDQLMTLLLLGHETTASALTWAVFWLLRHPDCLNRLQSELVAIGDNDRAI
AKAPYLDAVCREALRLQPIALIAQPRRVASPLSLGGYDFASGTILVPCVLTAHRRAATYP
NPDQFQPNRFLERRFSNGEFLPFGGGQRSCIGMALSLIEMKMVLATLLRQCQIAEVSQRP
VRPARRGITFVPSQDFRIQVQQWHNPSAQTAIASV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory