Comparing Synpcc7942_1440 FitnessBrowser__SynE:Synpcc7942_1440 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
P00547 Homoserine kinase; HK; HSK; EC 2.7.1.39 from Escherichia coli (strain K12) (see paper)
34% identity, 88% coverage: 3:271/306 of query aligns to 2:279/310 of P00547
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
38% identity, 92% coverage: 5:287/306 of query aligns to 12:295/295 of 6cyzA
Q8L7R2 Homoserine kinase; Protein DOWNY MILDEW RESISTANT 1; EC 2.7.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 98% coverage: 1:300/306 of query aligns to 52:364/370 of Q8L7R2
Sites not aligning to the query:
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
27% identity, 95% coverage: 1:290/306 of query aligns to 1:289/296 of 1h74B
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
27% identity, 95% coverage: 1:290/306 of query aligns to 1:289/296 of 1h74A
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
27% identity, 95% coverage: 1:290/306 of query aligns to 1:289/296 of 1h73A
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
27% identity, 95% coverage: 1:290/306 of query aligns to 1:289/296 of 1h72C
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
27% identity, 95% coverage: 1:290/306 of query aligns to 1:289/296 of 1fwkA
>Synpcc7942_1440 FitnessBrowser__SynE:Synpcc7942_1440
MRVRVAVPATTANLGPGFDCLGAALTLYNHFWFAPASTGELEITARGMDAEKISGDRDNL
VYRAFAAFFEKQEQPVPALKLEIELAVPLARGLGSSATAIVAGLVGANALAGSPWSNAQL
CDLATELEGHPDNVVPALLGGCRLAARDRQNQWAIADLDWHPDFIPVVAIPDFELSTEAA
RQVLPTQYSRSDAIFNAAHVGLVVRSLASGNGEWLAAALQDRLHQPYRQALIPGYAAVET
AALEAGAFGLVISGAGPTLLAISSPDRAEAVRQAMLTTWQATGLSVRAEILAIAESGTQI
EQETEN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory