Comparing Synpcc7942_1481 FitnessBrowser__SynE:Synpcc7942_1481 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P33734 Imidazole glycerol phosphate synthase hisHF; IGP synthase; IGPS; ImGP synthase; EC 4.3.2.10; EC 3.5.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
34% identity, 94% coverage: 5:207/217 of query aligns to 2:211/552 of P33734
Sites not aligning to the query:
1ox5A Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
35% identity, 94% coverage: 5:207/217 of query aligns to 5:214/532 of 1ox5A
Sites not aligning to the query:
1ox4B Towards understanding the mechanism of the complex cyclization reaction catalyzed by imidazole glycerophosphate synthase (see paper)
35% identity, 94% coverage: 5:207/217 of query aligns to 5:214/538 of 1ox4B
Sites not aligning to the query:
7ac8B Molecular basis for the unique allosteric activation mechanism of the heterodimeric imidazole glycerol phosphate synthase complex. (see paper)
31% identity, 92% coverage: 6:205/217 of query aligns to 4:196/202 of 7ac8B
2nv2J Structure of the plp synthase complex pdx1/2 (yaad/e) from bacillus subtilis (see paper)
34% identity, 45% coverage: 15:111/217 of query aligns to 11:106/196 of 2nv2J
Sites not aligning to the query:
P37528 Pyridoxal 5'-phosphate synthase subunit PdxT; Pdx2; Pyridoxal 5'-phosphate synthase glutaminase subunit; EC 4.3.3.6; EC 3.5.1.2 from Bacillus subtilis (strain 168) (see 2 papers)
34% identity, 45% coverage: 15:111/217 of query aligns to 11:106/196 of P37528
Sites not aligning to the query:
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
34% identity, 60% coverage: 75:205/217 of query aligns to 69:181/475 of 2ywcA
Sites not aligning to the query:
>Synpcc7942_1481 FitnessBrowser__SynE:Synpcc7942_1481
MASTPQIAVVDYDMGNLHSACKGLEAAGANPIVTADPATILAADGVLLPGVGAFDPAMDH
LRDRQLIEPLHQAATSGKPFLGICLGLQLLFEASEEGQSAGLGILPGRVQRFRSEPGLVI
PHMGWNQLQLQQPDCPLWQNLGADPWFYFVHTYYVVPSEPTLTAATVQHGSQPVTAAIAR
DRLWAVQFHPEKSAKAGLQLLANFVTQVAAAQLQTVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory