Comparing Synpcc7942_1490 FitnessBrowser__SynE:Synpcc7942_1490 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8wm7C Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
57% identity, 98% coverage: 4:652/663 of query aligns to 2:653/658 of 8wm7C
8w9mC Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
71% identity, 38% coverage: 4:258/663 of query aligns to 2:256/256 of 8w9mC
8wm7D Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
56% identity, 38% coverage: 4:254/663 of query aligns to 4:253/257 of 8wm7D
8w9mD Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
56% identity, 38% coverage: 4:254/663 of query aligns to 2:251/256 of 8w9mD
2i4bA Crystal structure of bicarbonate transport protein cmpa from synechocystis sp. Pcc 6803 in complex with bicarbonate and calcium (see paper)
30% identity, 56% coverage: 277:645/663 of query aligns to 6:400/401 of 2i4bA
P73452 Nitrate/nitrite binding protein NrtA from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
29% identity, 55% coverage: 277:643/663 of query aligns to 60:441/446 of P73452
2g29A Crystal structure of the periplasmic nitrate-binding protein nrta from synechocystis pcc 6803 (see paper)
29% identity, 55% coverage: 277:643/663 of query aligns to 4:385/385 of 2g29A
8hprD Lpqy-sugabc in state 4 (see paper)
40% identity, 33% coverage: 5:221/663 of query aligns to 3:216/362 of 8hprD
8hprC Lpqy-sugabc in state 4 (see paper)
40% identity, 33% coverage: 5:221/663 of query aligns to 3:216/363 of 8hprC
8hplC Lpqy-sugabc in state 1 (see paper)
40% identity, 33% coverage: 5:221/663 of query aligns to 3:214/384 of 8hplC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
41% identity, 30% coverage: 24:221/663 of query aligns to 21:225/375 of 2d62A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 32% coverage: 1:215/663 of query aligns to 14:224/378 of P69874
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
38% identity, 33% coverage: 5:221/663 of query aligns to 4:217/393 of P9WQI3
1g291 Malk (see paper)
39% identity, 31% coverage: 20:226/663 of query aligns to 14:227/372 of 1g291
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
38% identity, 29% coverage: 29:221/663 of query aligns to 46:245/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
38% identity, 29% coverage: 29:221/663 of query aligns to 46:245/382 of 7aheC
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
40% identity, 33% coverage: 5:226/663 of query aligns to 7:216/353 of 1vciA
7ahdC Opua (e190q) occluded (see paper)
37% identity, 29% coverage: 29:221/663 of query aligns to 46:245/260 of 7ahdC
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
39% identity, 33% coverage: 5:226/663 of query aligns to 3:220/374 of 2awnB
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
39% identity, 33% coverage: 5:226/663 of query aligns to 4:221/371 of P68187
Sites not aligning to the query:
>Synpcc7942_1490 FitnessBrowser__SynE:Synpcc7942_1490
MSLFVAVENIEKSFPLSGGNEYLALKGIDLEIKQGEFISLIGHSGCGKSTLLNLIAGLEL
PTDGAVSLEGQQITAPGPDRMVVFQNYSLFPWLTVRENIALAVDEVLRDLPKEERQAIVE
EHIQLVGLGHAADKPPAQLSGGMKQRVAIARGLATRPKLLLLDEPFGALDALTRGNLQEK
LMQICEENHVTAVMVTHDVDEAVLLSDRIVMLTNGPGSKIGGILEVDIPRPRKRMDVVHH
PSYYSLRSEIIYFLNQQKRVKKLNARKVTTVARHGLEKVNLEIGYVPLMACAPLVVAQEK
AFFAKHGLDEVSLVRETSWRGIVDGLTENYLDAAQMPAGMPVWMSVGGQGGSPLPIVSSL
TMSRNGNGITLSKALYDEGIQTVDDFRNLLRSTADKQHIMGIVHPASMHNLLLRYWLAAN
QIDPDRDVQLRTIPPAQMVADLKDGTIDGYCIGEPWNAWAAQKEIGFTIASDLEIWNGHP
GKVLGVREDWANRYPNSHVALVKALLEACQYCEDPANWDELRELLSDRRYLSCPKEYIQF
SQSTADDLAVPHHRFAGAGVNRPSRTEHLWMMTQLARWGDVPFPRNWVEILERVCRVGVF
STAARELGLSEVVNYQRSTPVELFDGVPFNAEDPIAYLNSLPIHRDFSVAEIALDQPRPI
AAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory