SitesBLAST
Comparing Synpcc7942_1501 FitnessBrowser__SynE:Synpcc7942_1501 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
42% identity, 96% coverage: 18:542/546 of query aligns to 1:518/526 of 3dc2A
- active site: N96 (= N113), R230 (= R247), D254 (= D271), E259 (= E276), H277 (= H296)
- binding serine: Y458 (≠ H479), D460 (= D481), R461 (≠ M482), P462 (= P483), G463 (= G484), A464 (≠ I485), L465 (≠ I486), L484 (≠ V505)
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
41% identity, 96% coverage: 17:542/546 of query aligns to 1:517/525 of 3ddnB
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
40% identity, 79% coverage: 20:452/546 of query aligns to 8:440/533 of O43175
- T78 (≠ V89) binding
- R135 (= R146) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ KI 166:167) binding
- D175 (= D186) binding
- T207 (≠ I218) binding
- CAR 234:236 (= CAR 245:247) binding
- D260 (= D271) binding
- V261 (= V272) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (= HLGA 296:299) binding
- A373 (= A386) to T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- G377 (= G390) to S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- V425 (≠ A437) to M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
47% identity, 55% coverage: 20:322/546 of query aligns to 4:305/305 of 6plfA
7dkmA Phgdh covalently linked to oridonin (see paper)
47% identity, 55% coverage: 20:320/546 of query aligns to 4:303/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V89), A102 (= A117), G148 (= G163), R151 (≠ K166), I152 (= I167), Y170 (= Y185), D171 (= D186), P172 (= P187), I173 (≠ F188), H202 (= H217), T203 (≠ I218), P204 (= P219), T209 (= T224), C230 (= C245), A231 (= A246), R232 (= R247), H279 (= H296), G281 (= G298)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (≠ V30), K17 (≠ D33), I18 (= I34), E293 (≠ V310)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
47% identity, 55% coverage: 20:320/546 of query aligns to 3:302/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V162), G147 (= G163), L148 (= L164), G149 (= G165), R150 (≠ K166), I151 (= I167), G152 (= G168), D170 (= D186), H201 (= H217), T202 (≠ I218), P203 (= P219)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
47% identity, 55% coverage: 20:320/546 of query aligns to 3:302/302 of 6rihA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
47% identity, 55% coverage: 20:320/546 of query aligns to 3:302/303 of 6plgA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
47% identity, 55% coverage: 20:319/546 of query aligns to 3:301/301 of 6rj5A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
47% identity, 55% coverage: 20:318/546 of query aligns to 2:299/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N113), A100 (= A117), R149 (≠ K166), I150 (= I167), Y168 (= Y185), D169 (= D186), P170 (= P187), I171 (≠ F188), H200 (= H217), T201 (≠ I218), P202 (= P219), T207 (= T224), C228 (= C245), A229 (= A246), R230 (= R247), H277 (= H296), G279 (= G298)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
47% identity, 54% coverage: 20:316/546 of query aligns to 2:297/297 of 6rj3A
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
47% identity, 55% coverage: 21:320/546 of query aligns to 1:299/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G165), I148 (= I167), Y166 (= Y185), D167 (= D186), P168 (= P187), I169 (≠ F188), I170 (= I189), H198 (= H217), T199 (≠ I218), L208 (= L227), R228 (= R247)
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
46% identity, 55% coverage: 20:319/546 of query aligns to 2:292/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ K166), Y160 (= Y185), D161 (= D186), P162 (= P187), I164 (= I189), L179 (= L204), T193 (≠ I218), P194 (= P219), S198 (≠ E223), L202 (= L227)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
42% identity, 55% coverage: 20:322/546 of query aligns to 2:304/304 of 1wwkA
- active site: S96 (≠ N113), R230 (= R247), D254 (= D271), E259 (= E276), H278 (= H296)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ A117), G146 (= G163), F147 (≠ L164), G148 (= G165), R149 (≠ K166), I150 (= I167), Y168 (= Y185), D169 (= D186), P170 (= P187), V201 (≠ I218), P202 (= P219), T207 (= T224), T228 (≠ C245), S229 (≠ A246), D254 (= D271), H278 (= H296), G280 (= G298)
2eklA Structure of st1218 protein from sulfolobus tokodaii
41% identity, 53% coverage: 20:309/546 of query aligns to 6:295/312 of 2eklA
- active site: S100 (≠ N113), R232 (= R247), D256 (= D271), E261 (= E276), H282 (= H296)
- binding nicotinamide-adenine-dinucleotide: I76 (≠ V89), S100 (≠ N113), G148 (= G163), G150 (= G165), R151 (≠ K166), I152 (= I167), Y170 (= Y185), D171 (= D186), I172 (≠ P187), L173 (≠ F188), H202 (= H217), V203 (≠ I218), T204 (≠ P219), I212 (≠ L227), T230 (≠ C245), S231 (≠ A246), D256 (= D271), G284 (= G298)
7cvpA The crystal structure of human phgdh from biortus.
46% identity, 41% coverage: 95:318/546 of query aligns to 33:254/254 of 7cvpA
- binding nicotinamide-adenine-dinucleotide: G101 (= G163), G103 (= G165), R104 (≠ K166), I105 (= I167), Y123 (= Y185), D124 (= D186), P125 (= P187), I126 (≠ F188), H155 (= H217), T156 (≠ I218), P157 (= P219), T162 (= T224), C183 (= C245), A184 (= A246), R185 (= R247), H232 (= H296), G234 (= G298)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
38% identity, 55% coverage: 19:316/546 of query aligns to 3:308/334 of 5aovA
- active site: L100 (≠ N113), R241 (= R247), D265 (= D271), E270 (= E276), H288 (= H296)
- binding glyoxylic acid: M52 (≠ R65), L53 (≠ S66), L53 (≠ S66), Y74 (≠ A87), A75 (≠ G88), V76 (= V89), G77 (= G90), R241 (= R247), H288 (= H296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V89), T104 (≠ A117), F158 (≠ L164), G159 (= G165), R160 (≠ K166), I161 (= I167), S180 (≠ D186), R181 (≠ P187), A211 (≠ H217), V212 (≠ I218), P213 (= P219), T218 (= T224), I239 (≠ C245), A240 (= A246), R241 (= R247), H288 (= H296), G290 (= G298)
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
36% identity, 57% coverage: 20:332/546 of query aligns to 57:380/466 of P87228
- S87 (= S48) modified: Phosphoserine
- S258 (≠ T221) modified: Phosphoserine
5ofwA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 3-chloro-4-fluorobenzamide (see paper)
47% identity, 36% coverage: 112:305/546 of query aligns to 2:193/195 of 5ofwA
- active site: N3 (= N113), R137 (= R247), D161 (= D271), E166 (= E276), H184 (= H296)
- binding 3-chloranyl-4-fluoranyl-benzamide: G53 (= G163), Y75 (= Y185), P77 (= P187), T108 (≠ I218), S113 (≠ E223), T114 (= T224), L117 (= L227)
5ofvA Crystal structure of human 3-phosphoglycerate dehydrogenase in complex with 5-fluoro-2-methylbenzoic acid (see paper)
47% identity, 36% coverage: 112:305/546 of query aligns to 2:193/195 of 5ofvA
Query Sequence
>Synpcc7942_1501 FitnessBrowser__SynE:Synpcc7942_1501
MIGRICGSSIPVARWLTMPKVLVSDPIDQVGLDILSQVAQVDVKTGLSPSELAQIIGEYD
ALMLRSGTRVTAEVIEAGQKLRIIGRAGVGVDNVDVPAATRRGIVVVNSPEGNTIAAAEH
TLAMMLSLSRHIPDANASTKSGGWDRKSFVGTEVYKKTLGVVGLGKIGSHVATVAKAMGM
KLLAYDPFISAERAEQIGARLVELDILFQEADYITLHIPKTPETANLINAETLAKMKPTT
RIINCARGGVINEQALADAIAAGKIGGAALDVYDQEPLQADSPLRALGKNLILTPHLGAS
TTEAQVNVAVDVAEQIRDVLLGLPARSAVNIPGLYPDILEKLRPYLQLAETLGNLLSQVA
GGRLEQLTVRLQGELAAQQSQPIVVAALKGLLTQALRERVNYVNAMIEAKERGIRIIETR
DESVRDDYAGGSLQLVATGSNGEHRVMGALLGDGEIRITNVDEFPVNVPPSRYMLFTRHR
DMPGIIGKIGSLLGSFNVNIASMQVGRRIVRGDAVMVLSLDDPLPEGILAEITKVAGISD
AYTVVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory