SitesBLAST
Comparing Synpcc7942_1573 FitnessBrowser__SynE:Synpcc7942_1573 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
40% identity, 96% coverage: 4:259/266 of query aligns to 5:250/261 of P40288
- 11:35 (vs. 10:34, 56% identical) binding
- E96 (= E105) mutation E->A,G,K: Heat stable.
- D108 (= D117) mutation to N: Heat stable.
- V112 (= V121) mutation to A: Heat stable.
- E133 (= E142) mutation to K: Heat stable.
- V183 (≠ I192) mutation to I: Heat stable.
- P194 (= P203) mutation to Q: Heat stable.
- E210 (≠ L219) mutation to K: Heat stable.
- Y217 (≠ R226) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
40% identity, 96% coverage: 4:259/266 of query aligns to 11:256/267 of 3ay6B
- active site: G24 (= G17), S151 (= S154), Y164 (= Y167), K168 (= K171)
- binding beta-D-glucopyranose: E102 (= E105), S151 (= S154), H153 (= H156), W158 (≠ F161), Y164 (= Y167), N202 (= N205), K205 (≠ L208)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G13), T23 (≠ Q16), G24 (= G17), L25 (≠ I18), Y45 (≠ R38), D71 (= D74), V72 (≠ L75), N98 (= N101), A99 (= A102), G100 (= G103), V101 (≠ M104), M149 (≠ I152), S151 (= S154), Y164 (= Y167), K168 (= K171), P194 (= P197), G195 (= G198), M197 (≠ I200), T199 (= T202), P200 (= P203), I201 (= I204), N202 (= N205)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
39% identity, 96% coverage: 4:259/266 of query aligns to 5:250/261 of 1g6kA
- active site: G18 (= G17), S145 (= S154), Y158 (= Y167), K162 (= K171)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ Q16), G18 (= G17), L19 (≠ I18), R39 (= R38), D65 (= D74), V66 (≠ L75), N92 (= N101), A93 (= A102), G94 (= G103), M143 (≠ I152), S145 (= S154), Y158 (= Y167), P188 (= P197), G189 (= G198), I191 (= I200), T193 (= T202)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
42% identity, 96% coverage: 4:258/266 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G13), M16 (≠ I18), D35 (≠ Y37), I36 (≠ R38), I62 (≠ L75), N88 (= N101), G90 (= G103), I138 (= I152), S140 (= S154), Y152 (= Y167), K156 (= K171), I185 (= I200)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
42% identity, 96% coverage: 4:258/266 of query aligns to 3:242/248 of Q9KJF1
- S15 (≠ Q16) binding
- D36 (≠ Y37) binding
- D62 (= D74) binding
- I63 (≠ L75) binding
- N89 (= N101) binding
- Y153 (= Y167) binding
- K157 (= K171) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
40% identity, 97% coverage: 4:260/266 of query aligns to 3:246/247 of 4jroC
- active site: G16 (= G17), S142 (= S154), Q152 (≠ F164), Y155 (= Y167), K159 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ Q16), G16 (= G17), I17 (= I18), N35 (≠ D36), Y36 (= Y37), N37 (≠ R38), G38 (≠ S39), S39 (≠ H40), N63 (≠ D74), V64 (≠ L75), N90 (= N101), A91 (= A102), I93 (≠ M104), I113 (≠ V124), S142 (= S154), Y155 (= Y167), K159 (= K171), P185 (= P197), I188 (= I200), T190 (= T202)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
39% identity, 94% coverage: 9:259/266 of query aligns to 7:244/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
39% identity, 94% coverage: 9:259/266 of query aligns to 4:237/239 of 3sj7A
- active site: G12 (= G17), S138 (= S154), Q148 (≠ F164), Y151 (= Y167), K155 (= K171)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (= S15), R11 (≠ Q16), I13 (= I18), N31 (≠ D36), Y32 (= Y37), A33 (≠ R38), G34 (≠ S39), S35 (≠ H40), A58 (= A73), N59 (≠ D74), V60 (≠ L75), N86 (= N101), A87 (= A102), T109 (≠ V124), S138 (= S154), Y151 (= Y167), K155 (= K171), P181 (= P197), G182 (= G198)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
37% identity, 97% coverage: 3:259/266 of query aligns to 13:257/261 of 5u9pB
- active site: G27 (= G17), S152 (= S154), Y165 (= Y167), K169 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G13), R26 (≠ Q16), G27 (= G17), I28 (= I18), R48 (= R38), D73 (= D74), V74 (≠ L75), N100 (= N101), A101 (= A102), I150 (= I152), Y165 (= Y167), K169 (= K171), P195 (= P197), F198 (≠ I200), T200 (= T202), L202 (≠ I204), N203 (= N205)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
38% identity, 97% coverage: 4:262/266 of query aligns to 4:252/252 of 1vl8B
- active site: G17 (= G17), S143 (= S154), I154 (≠ F164), Y157 (= Y167), K161 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), R16 (≠ Q16), G17 (= G17), L18 (≠ I18), S37 (≠ Y37), R38 (= R38), C63 (≠ A73), D64 (= D74), V65 (≠ L75), A91 (≠ N101), A92 (= A102), G93 (= G103), I94 (≠ M104), V114 (= V124), I141 (= I152), S143 (= S154), Y157 (= Y167), K161 (= K171), P187 (= P197), G188 (= G198), Y190 (≠ I200), T192 (= T202), M194 (≠ I204), T195 (≠ N205)
6oz7A Putative oxidoreductase from escherichia coli str. K-12
35% identity, 95% coverage: 7:260/266 of query aligns to 2:233/242 of 6oz7A
7nm8AAA Antimycin pathway standalone ketoreductase, AntM (see paper)
41% identity, 95% coverage: 6:259/266 of query aligns to 6:248/251 of 7nm8AAA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), S15 (= S15), R16 (≠ Q16), G17 (= G17), I18 (= I18), H36 (≠ D36), Y37 (= Y37), G38 (≠ R38), H39 (≠ S39), L65 (= L75), N97 (= N101), G99 (= G103), S147 (= S154), Y160 (= Y167), K164 (= K171), G191 (= G198), T193 (≠ I200), T195 (= T202)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
38% identity, 97% coverage: 1:259/266 of query aligns to 6:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (= S15), K21 (≠ Q16), G22 (= G17), I23 (= I18), A43 (≠ R38), S44 (= S39), S45 (≠ H40), G68 (≠ A73), D69 (= D74), V70 (≠ L75), N96 (= N101), S97 (≠ A102), G98 (= G103), Y100 (≠ E105), I144 (= I152), S146 (= S154), Y159 (= Y167), K163 (= K171), P189 (= P197), G190 (= G198), M191 (≠ A199), I192 (= I200), T194 (= T202), G196 (≠ I204), T197 (≠ N205)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S154), Y159 (= Y167), M191 (≠ A199), I202 (≠ N210)
3iccA Crystal structure of a putative 3-oxoacyl-(acyl carrier protein) reductase from bacillus anthracis at 1.87 a resolution (see paper)
38% identity, 96% coverage: 4:258/266 of query aligns to 5:252/255 of 3iccA
- active site: G18 (= G17), S148 (= S154), F158 (= F164), Y161 (= Y167), K165 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), S16 (= S15), R17 (≠ Q16), G18 (= G17), I19 (= I18), H37 (≠ D36), Y38 (= Y37), G39 (≠ R38), L66 (= L60), E67 (≠ A61), N98 (= N101), G100 (= G103), I146 (= I152), S148 (= S154), Y161 (= Y167), K165 (= K171), P191 (= P197), G192 (= G198), M198 (≠ I204), N199 (= N205)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
36% identity, 96% coverage: 4:259/266 of query aligns to 3:243/245 of 5wuwA
- active site: G16 (= G17), S140 (= S154), Y154 (= Y167), L161 (≠ I174)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), R15 (≠ Q16), I17 (= I18), Y36 (= Y37), A37 (≠ R38), A38 (≠ S39), D63 (= D74), S64 (≠ L75), N90 (= N101), A91 (= A102), G92 (= G103), Y154 (= Y167), K158 (= K171), G185 (= G198), P186 (≠ A199), V187 (≠ I200)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
36% identity, 98% coverage: 1:260/266 of query aligns to 1:245/247 of P73574
- A14 (≠ S14) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P162) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K171) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ A199) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ L209) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
40% identity, 97% coverage: 4:260/266 of query aligns to 3:238/240 of 4dmmB
- active site: G16 (= G17), S142 (= S154), Q152 (≠ F164), Y155 (= Y167), K159 (= K171)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ Q16), G16 (= G17), I17 (= I18), A37 (≠ R38), S38 (= S39), S39 (≠ H40), A62 (= A73), D63 (= D74), V64 (≠ L75), N90 (= N101), A91 (= A102), L113 (≠ V124), I140 (= I152), S142 (= S154), Y155 (= Y167), K159 (= K171), P185 (= P197), G186 (= G198), I188 (= I200), T190 (= T213), M192 (≠ L215)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
37% identity, 98% coverage: 1:260/266 of query aligns to 2:243/244 of 4nbuB
- active site: G18 (= G17), N111 (= N125), S139 (= S154), Q149 (≠ F164), Y152 (= Y167), K156 (= K171)
- binding acetoacetyl-coenzyme a: D93 (≠ R107), K98 (≠ E112), S139 (= S154), N146 (≠ F161), V147 (≠ P162), Q149 (≠ F164), Y152 (= Y167), F184 (≠ A199), M189 (≠ I204), K200 (≠ A217)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), N17 (≠ Q16), G18 (= G17), I19 (= I18), D38 (= D36), F39 (≠ Y37), V59 (≠ A73), D60 (= D74), V61 (≠ L75), N87 (= N101), A88 (= A102), G89 (= G103), I90 (≠ M104), T137 (≠ I152), S139 (= S154), Y152 (= Y167), K156 (= K171), P182 (= P197), F184 (≠ A199), T185 (≠ I200), T187 (= T202), M189 (≠ I204)
1ybvA Structure of trihydroxynaphthalene reductase in complex with NADPH and an active site inhibitor (see paper)
34% identity, 96% coverage: 4:258/266 of query aligns to 14:267/270 of 1ybvA
- active site: G27 (= G17), S151 (= S154), H162 (≠ F164), Y165 (= Y167), K169 (= K171), Y210 (vs. gap)
- binding 5-methyl-1,2,4-triazolo[3,4-b]benzothiazole: S151 (= S154), Y165 (= Y167), G197 (≠ A199), M202 (vs. gap), Y203 (vs. gap), Y210 (vs. gap), W230 (≠ N221)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G23 (= G13), R26 (≠ Q16), G27 (= G17), I28 (= I18), A48 (≠ R38), N49 (≠ S39), S50 (≠ H40), N74 (≠ D74), V75 (≠ L75), N101 (= N101), S102 (≠ A102), G103 (= G103), M149 (≠ I152), S151 (= S154), K169 (= K171), P195 (= P197), G197 (≠ A199), I198 (= I200), T200 (= T202), M202 (vs. gap)
1g0nA Structure of trihydroxynaphthalene reductase in complex with NADPH and 4,5,6,7-tetrachloro-phthalide (see paper)
34% identity, 96% coverage: 4:258/266 of query aligns to 17:270/273 of 1g0nA
- active site: G30 (= G17), S154 (= S154), H165 (≠ F164), Y168 (= Y167), K172 (= K171)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G26 (= G13), R29 (≠ Q16), G30 (= G17), I31 (= I18), A51 (≠ R38), N52 (≠ S39), S53 (≠ H40), V78 (≠ L75), N104 (= N101), S105 (≠ A102), G106 (= G103), I127 (≠ V124), M152 (≠ I152), Y168 (= Y167), K172 (= K171), P198 (= P197), G200 (≠ A199), I201 (= I200), T203 (= T202), M205 (vs. gap)
- binding 4,5,6,7-tetrachloro-phthalide: S154 (= S154), Y168 (= Y167), G200 (≠ A199), M205 (vs. gap), Y206 (vs. gap), C210 (vs. gap), Y213 (vs. gap), W233 (≠ N221)
Query Sequence
>Synpcc7942_1573 FitnessBrowser__SynE:Synpcc7942_1573
MGKLDNQIALVTGSSQGIGQEIAIRLASEGASVVIDYRSHPEGAEETRKQVEAAGAQCHL
AKDHAPEGYVVQADLGDVTQVRNLVAESIKHFGKLDILVNNAGMERRAPFWEVTEADYDM
VLNVNLKGAFFAAQALVQHLLETKRPGKIINISSVHEELPFPNFASYCLSKGGIKMMTRD
LAVELGEYGITINNVAPGAIETPINTNLLNNPTELNALLGNIPLKRLGKPKDIASLVLFL
ASPDADYITGTTIFADGGLLWNYHEQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory