SitesBLAST
Comparing Synpcc7942_1596 FitnessBrowser__SynE:Synpcc7942_1596 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9P7B4 NADP-dependent 3-hydroxy acid dehydrogenase; L-allo-threonine dehydrogenase; EC 1.1.1.381 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 97% coverage: 4:241/245 of query aligns to 1:246/259 of Q9P7B4
- S42 (≠ G44) modified: Phosphoserine
- T43 (≠ R45) modified: Phosphothreonine
2bd0D Chlorobium tepidum sepiapterin reductase complexed with NADP and sepiapterin (see paper)
30% identity, 95% coverage: 12:243/245 of query aligns to 4:238/240 of 2bd0D
- active site: S144 (= S146), Y157 (= Y159), K161 (= K163)
- binding biopterin: F98 (≠ T100), S144 (= S146), Y157 (= Y159), M194 (≠ L196), W195 (= W197)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), K11 (≠ S19), I13 (= I21), S39 (≠ G40), R40 (= R41), T41 (≠ D42), D65 (= D67), I66 (≠ L68), N92 (= N94), G94 (= G96), V95 (≠ T97), T115 (≠ L117), S144 (= S146), Y157 (= Y159), K161 (= K163), P187 (= P189), A189 (≠ S191), V190 (= V192), T192 (= T194), P193 (≠ A195), M194 (≠ L196), W195 (= W197)
2bd0A Chlorobium tepidum sepiapterin reductase complexed with NADP and sepiapterin (see paper)
30% identity, 95% coverage: 12:243/245 of query aligns to 4:238/240 of 2bd0A
- active site: S144 (= S146), Y157 (= Y159), K161 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), K11 (≠ S19), G12 (= G20), I13 (= I21), R40 (= R41), T41 (≠ D42), D65 (= D67), I66 (≠ L68), N92 (= N94), A93 (= A95), G94 (= G96), V95 (≠ T97), T115 (≠ L117), I142 (≠ V144), S144 (= S146), K161 (= K163), P187 (= P189), A189 (≠ S191), V190 (= V192), T192 (= T194), P193 (≠ A195), M194 (≠ L196), W195 (= W197)
Q8KES3 Sepiapterin reductase; SPR; cSR; EC 1.1.1.325 from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) (see 2 papers)
30% identity, 95% coverage: 12:243/245 of query aligns to 5:239/244 of Q8KES3
- 9:15 (vs. 16:22, 71% identical) binding
- SRT 40:42 (≠ GRD 40:42) binding
- DI 66:67 (≠ DL 67:68) binding
- N93 (= N94) binding
- F99 (≠ T100) binding ; mutation to A: Drastically reduces activity. Complete loss of activity; when associated with A-196.
- T116 (≠ L117) binding
- S145 (= S146) binding
- Y158 (= Y159) binding ; binding
- K162 (= K163) binding
- VYTPMW 191:196 (≠ VDTALW 192:197) binding
- W196 (= W197) binding ; mutation to A: Drastically reduces activity. Complete loss of activity; when associated with A-99.
Q05016 NADP-dependent 3-hydroxy acid dehydrogenase; L-allo-threonine dehydrogenase; EC 1.1.1.-; EC 1.1.1.381 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
37% identity, 78% coverage: 7:196/245 of query aligns to 11:205/267 of Q05016
- N102 (= N94) binding
- Y168 (= Y159) binding
- K172 (= K163) binding
3rkuA Substrate fingerprint and the structure of NADP+ dependent serine dehydrogenase from saccharomyces cerevisiae complexed with NADP+
37% identity, 78% coverage: 7:196/245 of query aligns to 12:206/268 of 3rkuA
- active site: A107 (= A98), N128 (= N118), S156 (= S146), Y169 (= Y159), K173 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G16), S23 (= S18), G25 (= G20), I26 (= I21), R49 (= R41), R50 (≠ D42), D76 (= D67), I77 (≠ L68), N103 (= N94), A104 (= A95), G105 (= G96), K106 (≠ T97), S156 (= S146), Y169 (= Y159), K173 (= K163), P199 (= P189), G200 (= G190), V202 (= V192), T204 (= T194), E205 (≠ A195), F206 (≠ L196)
Sites not aligning to the query:
3rkrA Crystal structure of a metagenomic short-chain oxidoreductase (sdr) in complex with NADP (see paper)
32% identity, 96% coverage: 5:240/245 of query aligns to 1:218/221 of 3rkrA
- active site: G16 (= G20), S142 (= S146), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G16), R15 (≠ S19), A36 (≠ G40), R37 (= R41), D38 (= D42), C61 (≠ L66), D62 (= D67), L63 (= L68), A90 (= A95), G91 (= G96), V92 (≠ T97), G93 (≠ A98)
3p19A Improved NADPH-dependent blue fluorescent protein (see paper)
32% identity, 95% coverage: 9:240/245 of query aligns to 2:234/239 of 3p19A
- active site: S132 (= S146), Y145 (= Y159), K149 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G16), S11 (= S18), S12 (= S19), G13 (= G20), I14 (= I21), A33 (≠ G40), R34 (= R41), R35 (≠ D42), D53 (= D67), V54 (≠ L68), N80 (= N94), A81 (= A95), G82 (= G96), I130 (≠ V144), S132 (= S146), Y145 (= Y159), K149 (= K163), P175 (= P189), A177 (≠ S191), V178 (= V192), T180 (= T194), E181 (≠ A195), L182 (= L196)
8g89A Hsd17b13 in complex with cofactor and inhibitor (see paper)
32% identity, 87% coverage: 12:223/245 of query aligns to 38:247/285 of 8g89A
- binding nicotinamide-adenine-dinucleotide: G42 (= G16), H45 (≠ S19), G46 (= G20), I47 (= I21), D66 (≠ G40), I67 (≠ R41), V91 (≠ L66), D92 (= D67), C93 (≠ L68), N119 (= N94), A120 (= A95), G121 (= G96), I142 (≠ L117), S171 (= S146), Y184 (= Y159), K188 (= K163), P217 (= P189), V218 (≠ G190), F219 (≠ S191), V220 (= V192), T222 (= T194), F224 (≠ L196)
- binding 3-fluoro-N-({(1r,4r)-4-[(2-fluorophenoxy)methyl]-1-hydroxycyclohexyl}methyl)-4-hydroxybenzamide: S171 (= S146), C173 (≠ A148), I178 (≠ F153), P179 (= P154), Y180 (≠ D155), Y184 (= Y159), F219 (≠ S191), T225 (≠ W197), K226 (≠ D198)
Sites not aligning to the query:
8g84A Crystal structures of hsd17b13 complexes (see paper)
32% identity, 87% coverage: 12:223/245 of query aligns to 38:247/297 of 8g84A
- binding nicotinamide-adenine-dinucleotide: G42 (= G16), H45 (≠ S19), G46 (= G20), I47 (= I21), D66 (≠ G40), I67 (≠ R41), V91 (≠ L66), C93 (≠ L68), N119 (= N94), G121 (= G96), I142 (≠ L117), V169 (= V144), S171 (= S146), Y184 (= Y159), K188 (= K163), P217 (= P189), V220 (= V192), T222 (= T194), F224 (≠ L196)
8g9vE Crystal structures of 17-beta-hydroxysteroid dehydrogenase 13 (see paper)
32% identity, 78% coverage: 12:201/245 of query aligns to 39:230/293 of 8g9vE
- binding nicotinamide-adenine-dinucleotide: G43 (= G16), H46 (≠ S19), G47 (= G20), I48 (= I21), D67 (≠ G40), I68 (≠ R41), D93 (= D67), C94 (≠ L68), N120 (= N94), A121 (= A95), G122 (= G96), V170 (= V144), S172 (= S146), Y185 (= Y159), K189 (= K163), P218 (= P189), F220 (≠ S191), V221 (= V192), T223 (= T194), F225 (≠ L196)
- binding 4-{[2,5-dimethyl-3-(4-methylbenzene-1-sulfonyl)benzene-1-sulfonyl]amino}benzoic acid: S172 (= S146), V173 (≠ I147), C174 (≠ A148), I179 (≠ F153), Y185 (= Y159), V219 (≠ G190), F220 (≠ S191), F225 (≠ L196)
Sites not aligning to the query:
Q7Z5P4 17-beta-hydroxysteroid dehydrogenase 13; 17-beta-HSD 13; Hepatic retinol/retinal dehydrogenase; Short chain dehydrogenase/reductase family 16C member 3; Short-chain dehydrogenase/reductase 9; EC 1.1.1.-; EC 1.1.1.62; EC 1.1.1.105 from Homo sapiens (Human) (see 2 papers)
32% identity, 78% coverage: 12:201/245 of query aligns to 39:230/300 of Q7Z5P4
- GIG 47:49 (= GIG 20:22) mutation to AIA: Loss of retinol/retinal dehydrogenase activity.
- 69:84 (vs. 42:57, 19% identical) mutation Missing: Does not localize to lipid droplets.
- 85:93 (vs. 58:67, 40% identical) mutation Missing: Does not localize to lipid droplets.
- 94:106 (vs. 68:80, 23% identical) mutation Missing: Does not localize to lipid droplets.
- R97 (≠ L71) mutation to A: Decreased retinol/retinal dehydrogenase activity; when associated with A-101.
- Y101 (≠ G75) mutation to A: Decreased retinol/retinal dehydrogenase activity; when associated with A-97.
- N144 (= N118) mutation to A: Loss of retinol/retinal dehydrogenase activity.
- K153 (≠ Q127) mutation to A: Loss of retinol/retinal dehydrogenase activity; when associated with A-156.
- L156 (= L130) mutation to A: Loss of retinol/retinal dehydrogenase activity; when associated with A-153.
- S172 (= S146) mutation to A: Loss of retinol/retinal dehydrogenase activity.
- Y185 (= Y159) mutation to A: Loss of retinol/retinal dehydrogenase activity; when associated with A-189.
- K189 (= K163) mutation to A: Loss of retinol/retinal dehydrogenase activity; when associated with A-185.
- L199 (= L173) mutation to A: Loss of retinol/retinal dehydrogenase activity; when associated with A-202.
- E202 (= E176) mutation to A: Loss of retinol/retinal dehydrogenase activity; when associated with A-199.
- K208 (≠ S179) mutation to A: Decreased retinol/retinal dehydrogenase activity.
Sites not aligning to the query:
- 22:28 mutation Missing: Does not localize to lipid droplets.
- 260 P → S: loss of retinol/retinal dehydrogenase activity; does not affect localization to lipid droplets; dbSNP:rs62305723
2cfcA Structural basis for stereo selectivity in the (r)- and (s)-hydroxypropylethane thiosulfonate dehydrogenases (see paper)
34% identity, 79% coverage: 9:202/245 of query aligns to 2:202/250 of 2cfcA
- active site: G13 (= G20), S142 (= S146), Y155 (= Y159), K159 (= K163)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (= F153), R152 (≠ W156), Y155 (= Y159), W195 (= W197), R196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G9 (= G16), S12 (= S19), G13 (= G20), N14 (≠ I21), D33 (≠ G40), L34 (≠ R41), A59 (≠ L66), D60 (= D67), V61 (≠ L68), N87 (= N94), A88 (= A95), G89 (= G96), I140 (≠ V144), P185 (= P189), G186 (= G190), M187 (≠ S191), I188 (≠ V192), T190 (= T194), P191 (≠ A195), M192 (≠ L196), T193 (vs. gap)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
34% identity, 79% coverage: 9:202/245 of query aligns to 2:202/250 of Q56840
- SGN 12:14 (≠ SGI 19:21) binding
- D33 (≠ G40) binding
- DV 60:61 (≠ DL 67:68) binding
- N87 (= N94) binding
- S142 (= S146) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (≠ W156) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y159) mutation Y->E,F: Loss of activity.
- K159 (= K163) mutation to A: Loss of activity.
- R179 (= R183) mutation to A: Loss of activity.
- IETPM 188:192 (≠ VDTAL 192:196) binding
- WR 195:196 (≠ W- 197) binding
- R196 (vs. gap) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 203 R→A: Slight decrease in catalytic efficiency.
- 209 R→A: Does not affect catalytic efficiency.
2ehdB Crystal structure analysis of oxidoreductase
33% identity, 93% coverage: 12:240/245 of query aligns to 7:212/213 of 2ehdB
6ixjA The crystal structure of sulfoacetaldehyde reductase from klebsiella oxytoca (see paper)
33% identity, 95% coverage: 9:240/245 of query aligns to 1:238/251 of 6ixjA
- binding 2-hydroxyethylsulfonic acid: S138 (= S146), Y145 (≠ F153), Y151 (= Y159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G16), T10 (≠ S18), S11 (= S19), G12 (= G20), F13 (≠ I21), R33 (= R41), R34 (≠ D42), D57 (= D67), V58 (≠ L68), N84 (= N94), A85 (= A95), G86 (= G96), T108 (≠ L117), I136 (≠ V144), S138 (= S146), Y151 (= Y159), K155 (= K163), P181 (= P189), G182 (= G190), A184 (≠ V192), T186 (= T194), E187 (≠ A195), F188 (≠ L196)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
30% identity, 85% coverage: 7:214/245 of query aligns to 3:216/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G16), Q15 (≠ S19), G16 (= G20), I17 (= I21), D36 (≠ G40), V63 (≠ L68), N89 (= N94), A91 (≠ G96), S94 (vs. gap), I142 (≠ V144), S143 (≠ A145), S144 (= S146), Y157 (= Y159), K161 (= K163), P187 (= P189), H188 (≠ G190), I190 (≠ V192), I194 (≠ L196)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
30% identity, 90% coverage: 7:226/245 of query aligns to 5:235/255 of 5itvA
- active site: G18 (= G20), S141 (= S146), Y154 (= Y159), K158 (= K163)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), S17 (= S19), G18 (= G20), I19 (= I21), D38 (≠ G40), I39 (≠ R41), T61 (= T63), I63 (≠ L68), N89 (= N94), G91 (= G96), T139 (≠ V144), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), I186 (≠ S191), I187 (≠ V192)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
32% identity, 81% coverage: 7:205/245 of query aligns to 5:200/227 of 5itvD
- active site: G18 (= G20), S141 (= S146), Y154 (= Y159), K158 (= K163)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G16), S17 (= S19), G18 (= G20), I19 (= I21), D38 (≠ G40), I39 (≠ R41), T61 (= T63), D62 (= D67), I63 (≠ L68), N89 (= N94), T139 (≠ V144), S141 (= S146), Y154 (= Y159), K158 (= K163), P184 (= P189), G185 (= G190), I187 (≠ V192)
3ai2A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH (see paper)
34% identity, 76% coverage: 13:197/245 of query aligns to 11:195/263 of 3ai2A
- active site: G18 (= G20), S144 (= S146), Y157 (= Y159), K161 (= K163)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G16), S16 (= S18), S17 (= S19), G18 (= G20), I19 (= I21), A38 (≠ G40), R39 (= R41), Q40 (≠ D42), V64 (≠ L66), D65 (= D67), V66 (≠ L68), N92 (= N94), G94 (= G96), N142 (≠ V144), Y157 (= Y159), K161 (= K163), P187 (= P189), I190 (≠ V192), T192 (= T194), W195 (= W197)
Query Sequence
>Synpcc7942_1596 FitnessBrowser__SynE:Synpcc7942_1596
MAGMSFLPSPFVLITGASSGIGAATAHAFAQAGWSLLLLGRDRGRLQSVAESARSQGAAA
VATYSLDLTNLTAIGPAIAQLVEQFGVPDVLINNAGTAQTGPLATLSLSDLECIFALNVH
SPLLVVQALLPGMRQRQRGLILNVASIAAQQAFPDWGAYCASKSALAAWSRVLAAEERSH
GIRVSLICPGSVDTALWDQPSVGANFDRQAMLRPETVAQVLLQVATLPETAVVDELTLMP
NAGTF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory