SitesBLAST
Comparing Synpcc7942_1639 FitnessBrowser__SynE:Synpcc7942_1639 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
40% identity, 95% coverage: 1:202/213 of query aligns to 4:220/276 of Q5M243
- Q90 (= Q72) mutation to A: No effect on ATPase, 10-fold decrease in riboflavin uptake; when associated with A-97 in EcfA2.
- E163 (= E145) mutation to Q: 10-fold decrease in ATPase and riboflavin uptake; when associated with Q-171 in EcfA2.
5x40A Structure of a cbio dimer bound with amppcp (see paper)
41% identity, 96% coverage: 3:206/213 of query aligns to 9:227/280 of 5x40A
- binding phosphomethylphosphonic acid adenylate ester: F14 (≠ W8), V18 (≠ S12), A20 (≠ I14), N40 (= N34), G41 (= G35), G43 (= G37), K44 (= K38), S45 (= S39), T46 (= T40), Q88 (= Q67), H139 (≠ Y118), M140 (≠ A119), L141 (= L120), S142 (= S121), G144 (= G123), Q145 (= Q124), Q166 (≠ E145), H198 (= H178)
- binding magnesium ion: S45 (= S39), Q88 (= Q67)
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
38% identity, 90% coverage: 15:206/213 of query aligns to 20:227/278 of 8bmpA
Sites not aligning to the query:
5d3mA Folate ecf transporter: amppnp bound state (see paper)
38% identity, 90% coverage: 15:206/213 of query aligns to 23:230/280 of 5d3mA
Sites not aligning to the query:
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
38% identity, 90% coverage: 15:206/213 of query aligns to 20:227/278 of 8bmsA
- binding adenosine-5'-triphosphate: N39 (= N34), G40 (= G35), S41 (= S36), G42 (= G37), K43 (= K38), S44 (= S39), T45 (= T40), Q88 (= Q67), Y133 (= Y112), N140 (≠ A119), S142 (= S121), G143 (= G122), G144 (= G123), Q145 (= Q124), Q166 (≠ E145), H199 (= H178)
- binding magnesium ion: S44 (= S39), Q88 (= Q67)
Sites not aligning to the query:
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
37% identity, 96% coverage: 1:204/213 of query aligns to 7:217/249 of 4hluC
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
36% identity, 96% coverage: 1:204/213 of query aligns to 6:213/247 of 4zirB
- binding phosphoaminophosphonic acid-adenylate ester: Y13 (≠ W8), V18 (≠ I14), N38 (= N34), G39 (= G35), G41 (= G37), K42 (= K38), T43 (≠ S39), T44 (= T40), Q80 (= Q67), N129 (≠ A119), S131 (= S121), G132 (= G122), G133 (= G123)
- binding magnesium ion: T43 (≠ S39), Q80 (= Q67)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 89% coverage: 14:202/213 of query aligns to 32:231/378 of P69874
- F45 (= F27) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ S36) mutation to T: Loss of ATPase activity and transport.
- L60 (= L42) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ C58) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V107) mutation to M: Loss of ATPase activity and transport.
- D172 (= D144) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 26 C→A: Lower ATPase activity and transport efficiency.
- 27 F→L: Lower ATPase activity and transport efficiency.
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
35% identity, 90% coverage: 15:206/213 of query aligns to 23:232/280 of Q5M244
- Q97 (= Q72) mutation to A: No effect on ATPase, 10-fold decrease in riboflavin uptake; when associated with A-90 in EcfA1.
- E171 (= E145) mutation to Q: 10-fold decrease in ATPase and riboflavin uptake; when associated with Q-163 in EcfA1.
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 95% coverage: 1:202/213 of query aligns to 6:217/369 of P19566
- L86 (≠ V74) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P146) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D151) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
A0R6H8 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
36% identity, 95% coverage: 3:204/213 of query aligns to 613:827/860 of A0R6H8
Sites not aligning to the query:
- 55 R→E: Cannot reduce Fe(III)-cMBT and Fe(III)-MBT; when associated with E-234 and E-241.
- 234 Q→E: Cannot reduce Fe(III)-cMBT and Fe(III)-MBT; when associated with E-55 and E-241.
- 241 R→E: Cannot reduce Fe(III)-cMBT and Fe(III)-MBT; when associated with E-55 and E-234.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
33% identity, 95% coverage: 1:202/213 of query aligns to 5:216/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (= W8), S37 (≠ N34), G38 (= G35), C39 (≠ S36), G40 (= G37), K41 (= K38), S42 (= S39), T43 (= T40), Q81 (= Q67), R128 (= R115), A132 (= A119), S134 (= S121), G136 (= G123), Q137 (= Q124), E158 (= E145), H191 (= H178)
- binding magnesium ion: S42 (= S39), Q81 (= Q67)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
33% identity, 95% coverage: 1:202/213 of query aligns to 5:216/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (= W8), G38 (= G35), C39 (≠ S36), G40 (= G37), K41 (= K38), S42 (= S39), T43 (= T40), R128 (= R115), S134 (= S121), Q137 (= Q124)
- binding beryllium trifluoride ion: S37 (≠ N34), G38 (= G35), K41 (= K38), Q81 (= Q67), S134 (= S121), G136 (= G123), H191 (= H178)
- binding magnesium ion: S42 (= S39), Q81 (= Q67)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
33% identity, 95% coverage: 1:202/213 of query aligns to 5:216/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (= W8), V17 (≠ I14), G38 (= G35), C39 (≠ S36), G40 (= G37), K41 (= K38), S42 (= S39), T43 (= T40), R128 (= R115), A132 (= A119), S134 (= S121), Q137 (= Q124)
- binding tetrafluoroaluminate ion: S37 (≠ N34), G38 (= G35), K41 (= K38), Q81 (= Q67), S134 (= S121), G135 (= G122), G136 (= G123), E158 (= E145), H191 (= H178)
- binding magnesium ion: S42 (= S39), Q81 (= Q67)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
33% identity, 95% coverage: 1:202/213 of query aligns to 5:216/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (= W8), V17 (≠ I14), G38 (= G35), C39 (≠ S36), G40 (= G37), K41 (= K38), S42 (= S39), T43 (= T40), R128 (= R115), A132 (= A119), S134 (= S121), Q137 (= Q124)
- binding magnesium ion: S42 (= S39), Q81 (= Q67)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
33% identity, 95% coverage: 1:202/213 of query aligns to 6:217/371 of P68187
- A85 (≠ L73) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ S92) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V100) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ A103) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ A105) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (= A110) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G123) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D144) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
33% identity, 95% coverage: 1:202/213 of query aligns to 5:216/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
33% identity, 95% coverage: 1:202/213 of query aligns to 3:214/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (= W8), S35 (≠ N34), G36 (= G35), C37 (≠ S36), G38 (= G37), K39 (= K38), S40 (= S39), T41 (= T40), R126 (= R115), A130 (= A119), S132 (= S121), G134 (= G123), Q135 (= Q124)
7pruA Structure of ctatm1 in the inward-facing partially occluded with cargo bound (see paper)
32% identity, 94% coverage: 3:202/213 of query aligns to 351:566/582 of 7pruA
Sites not aligning to the query:
7pr1A Structure of ctatm1 in the occluded conformation with atp bound (see paper)
32% identity, 94% coverage: 3:202/213 of query aligns to 354:569/587 of 7pr1A
- binding adenosine-5'-triphosphate: Y359 (≠ W8), G386 (= G35), G388 (= G37), K389 (= K38), S390 (= S39), T391 (= T40), Q431 (= Q67), M486 (≠ A119), S488 (= S121), G489 (= G122), G490 (= G123), E491 (≠ Q124), Q512 (≠ E145)
- binding magnesium ion: S390 (= S39), Q431 (= Q67), D511 (= D144)
Query Sequence
>Synpcc7942_1639 FitnessBrowser__SynE:Synpcc7942_1639
VRSLSFGWSPDSFILQDCDLQIPRGEFWMLLGDNGSGKSTLLRLIAGLLPLQSGTIACDR
PLGFVFQNPDHQLVMPTVGADVAFGLVEEGLSVTQAQERVAEALAAVRLAHYERRPIYAL
SGGQKQRVAIAGAIARHCELLLFDEPTALLDSDSQRDLVQQVQQLVRDRGLTALWVTHRL
EELEAADGACLLQQGRVVATGSVETVKACLNQL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory