Comparing Synpcc7942_1714 FitnessBrowser__SynE:Synpcc7942_1714 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
P45131 Homoserine O-acetyltransferase; HAT; Homoserine O-trans-acetylase; Homoserine transacetylase; HTA; EC 2.3.1.31 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
30% identity, 89% coverage: 13:313/338 of query aligns to 16:339/358 of P45131
Sites not aligning to the query:
Q6FEQ3 Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
29% identity, 82% coverage: 11:288/338 of query aligns to 22:327/387 of Q6FEQ3
2vatA Crystal structure of deacetylcephalosporin c acetyltransferase in complex with coenzyme a (see paper)
24% identity, 90% coverage: 7:311/338 of query aligns to 14:327/347 of 2vatA
Sites not aligning to the query:
2vavB Crystal structure of deacetylcephalosporin c acetyltransferase (dac- soak) (see paper)
23% identity, 90% coverage: 7:311/338 of query aligns to 15:329/350 of 2vavB
Sites not aligning to the query:
Q10341 Serine O-succinyltransferase; SST; EC 2.3.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 72% coverage: 11:254/338 of query aligns to 90:359/504 of Q10341
Sites not aligning to the query:
6iohA Crystal structure of homoserine o-acetyltransferase in complex with homoserine from mycobacterium smegmatis atcc 19420 (see paper)
24% identity, 91% coverage: 3:311/338 of query aligns to 11:344/375 of 6iohA
Sites not aligning to the query:
6ioiA Crystal structure of homoserine o-acetyltransferase in complex with coa from mycobacterium smegmatis atcc 19420 (see paper)
24% identity, 91% coverage: 3:311/338 of query aligns to 11:344/366 of 6ioiA
Sites not aligning to the query:
7rytB Crystal structure of mycobacterium tuberculosis acetylated homoserine transacetylase with coenzyme a (see paper)
29% identity, 58% coverage: 3:199/338 of query aligns to 10:223/368 of 7rytB
Sites not aligning to the query:
6puxA Homoserine transacetylase metx from mycobacterium tuberculosis (see paper)
29% identity, 58% coverage: 3:199/338 of query aligns to 11:224/366 of 6puxA
Sites not aligning to the query:
8f2lA Crystal structure of mycobacterium tuberculosis homoserine transacetylase in complex with l-homoserine (see paper)
29% identity, 58% coverage: 3:199/338 of query aligns to 10:223/367 of 8f2lA
Sites not aligning to the query:
5w8oB Homoserine transacetylase metx from mycobacterium hassiacum (see paper)
24% identity, 91% coverage: 3:311/338 of query aligns to 1:324/346 of 5w8oB
D2Z028 L-serine/homoserine O-acetyltransferase; Homoserine O-trans-acetylase; EC 2.3.1.30; EC 2.3.1.31 from Streptomyces lavendulae (see paper)
27% identity, 51% coverage: 8:178/338 of query aligns to 14:199/374 of D2Z028
>Synpcc7942_1714 FitnessBrowser__SynE:Synpcc7942_1714
MTVGTFRLPNFELDCGAVLPEASLVYATYGELNRDRSNAILYPTSYGAQHSTIDWLIGGD
RILDPDRWFIVIVNQFGNGLSSSPSNDPACGLAEQGFWFSHWDSVCAQQALLSQVLGIEQ
LALIYGWSMGAQQAYHWAIAFPDRVQRIAALCGTAKTTEHNRLFLESLRAALIADPTWDG
QRFQATPDRGYKAFARIYASWAASQAFYRAGIYRQQGYSSLEDYLERGWEANYRQRDPHD
LLAMIDTWLRCDVSDRPAFGGDLAKALGSITAQTLVMPSTTDLYFTPEDCEAEAQLIPKA
HYCPIPSIWGHRAGNPSQNPQDESFIRQAVQALLNAEA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory