SitesBLAST
Comparing Synpcc7942_1718 FitnessBrowser__SynE:Synpcc7942_1718 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
25% identity, 90% coverage: 38:420/425 of query aligns to 46:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (≠ L299), H369 (= H341), H376 (≠ W348), H414 (≠ A380)
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197), W322 (vs. gap), E413 (≠ A379), H414 (≠ A380), N450 (≠ A415)
- binding manganese (ii) ion: H369 (= H341), H376 (≠ W348), E413 (≠ A379)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/456 of 8jdrA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/456 of 8jdqA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/456 of 8jdoA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/456 of 8jdnA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/456 of 8jdgA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/456 of 8jdbA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
- binding (2R)-2-oxidanyloctanoic acid: V75 (≠ L67)
Sites not aligning to the query:
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/455 of 8jdxA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/455 of 8jduA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/456 of 8jdsA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/455 of 8jdpA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/455 of 8jdeA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/454 of 8jdvA
- binding 2-Ketohexanoic acid: V75 (≠ L67)
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
- binding 2-Ketohexanoic acid: 317, 321, 368, 375, 413
- binding flavin-adenine dinucleotide: 321, 322, 412, 413, 449
- binding manganese (ii) ion: 368, 375, 412
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/454 of 8jdzA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
- binding (3S)-3-methyl-2-oxopentanoic acid: 318, 322, 369, 376, 413
- binding flavin-adenine dinucleotide: 32, 322, 412, 413, 449
- binding manganese (ii) ion: 369, 376, 412
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
32% identity, 42% coverage: 38:216/425 of query aligns to 46:225/454 of 8jdyA
- binding flavin-adenine dinucleotide: P68 (= P60), G70 (= G62), T71 (≠ R63), G72 (= G64), T73 (= T65), G74 (≠ R66), G78 (= G70), V79 (≠ G71), L90 (≠ T82), P132 (= P124), G133 (= G127), A134 (≠ E128), G140 (≠ A134), M141 (≠ L135), A143 (≠ S137), T144 (= T138), A146 (≠ M140), S147 (= S141), E200 (≠ W191), G201 (= G192), I206 (= I197)
Sites not aligning to the query:
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
24% identity, 89% coverage: 42:418/425 of query aligns to 55:462/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ P60), G75 (= G62), S76 (≠ R63), G77 (= G64), T78 (= T65), G79 (≠ R66), L80 (= L67), A83 (vs. gap), C84 (vs. gap), P137 (= P124), G138 (≠ A126), E139 (≠ G127), A142 (≠ S130), T143 (≠ S131), G146 (≠ A134), N147 (≠ L135), S149 (= S137), T150 (= T138), A152 (≠ M140), G153 (≠ S141), E203 (≠ W191), G204 (= G192), I209 (= I197), E422 (≠ L378), H423 (≠ A379)
- binding fe (iii) ion: H377 (vs. gap), H384 (= H341), E422 (≠ L378)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
29% identity, 57% coverage: 25:265/425 of query aligns to 34:286/465 of 3pm9A
- active site: A149 (≠ M140), L159 (≠ S150)
- binding flavin-adenine dinucleotide: P69 (= P60), Q70 (≠ A61), G71 (= G62), G72 (≠ R63), N73 (≠ G64), T74 (= T65), G75 (≠ R66), L76 (= L67), G79 (= G70), Q80 (≠ G71), L91 (≠ T82), L133 (≠ P124), G134 (≠ I125), A135 (= A126), C139 (≠ S130), T140 (≠ S131), G142 (= G133), G143 (≠ A134), S146 (= S137), T147 (= T138), A149 (≠ M140), G150 (≠ S141), E200 (≠ W191), G201 (= G192), I205 (≠ L196), I206 (= I197)
Sites not aligning to the query:
5ae1B Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
26% identity, 59% coverage: 38:288/425 of query aligns to 118:377/539 of 5ae1B
- binding flavin-adenine dinucleotide: P140 (= P60), I141 (≠ A61), G142 (= G62), G143 (≠ R63), G144 (= G64), T145 (= T65), S146 (≠ R66), G150 (= G70), L151 (= L72), P208 (= P124), D209 (≠ I125), S210 (≠ A126), S214 (= S130), T215 (≠ S131), G218 (≠ A134), W219 (≠ L135), S221 (= S137), T222 (= T138), A224 (≠ M140), S225 (= S141), E274 (≠ W191), V279 (≠ L196), I280 (= I197)
Sites not aligning to the query:
6gouA Development of alkyl glycerone phosphate synthase inhibitors: complex with inhibitor 2i (see paper)
26% identity, 59% coverage: 38:288/425 of query aligns to 132:392/554 of 6gouA
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: D223 (≠ I125)
- binding flavin-adenine dinucleotide: P154 (= P60), I155 (≠ A61), G156 (= G62), G157 (≠ R63), G158 (= G64), T159 (= T65), S160 (≠ R66), V161 (≠ L67), G164 (= G70), P222 (= P124), D223 (≠ I125), S224 (≠ A126), S228 (= S130), T229 (≠ S131), G232 (≠ A134), W233 (≠ L135), S235 (= S137), T236 (= T138), A238 (≠ M140), S239 (= S141), E288 (≠ W191), V293 (≠ L196), I294 (= I197)
Sites not aligning to the query:
5ae3A Ether lipid-generating enzyme agps in complex with antimycin a (see paper)
26% identity, 59% coverage: 38:288/425 of query aligns to 118:378/539 of 5ae3A
- binding [(2R,3S,6S,7R,8R)-3-[(3-formamido-2-oxidanyl-phenyl)carbonylamino]-8-hexyl-2,6-dimethyl-4,9-bis(oxidanylidene)-1,5-dioxonan-7-yl] 3-methylbutanoate: R325 (≠ D241), M327 (≠ L243), Q331 (vs. gap), F334 (vs. gap), T349 (= T258)
- binding flavin-adenine dinucleotide: P140 (= P60), I141 (≠ A61), G142 (= G62), G143 (≠ R63), G144 (= G64), T145 (= T65), S146 (≠ R66), V147 (≠ L67), L151 (= L72), P208 (= P124), D209 (≠ I125), S210 (≠ A126), S214 (= S130), T215 (≠ S131), G218 (≠ A134), W219 (≠ L135), S221 (= S137), T222 (= T138), A224 (≠ M140), S225 (= S141), E274 (≠ W191), V279 (≠ L196), I280 (= I197)
Sites not aligning to the query:
- binding [(2R,3S,6S,7R,8R)-3-[(3-formamido-2-oxidanyl-phenyl)carbonylamino]-8-hexyl-2,6-dimethyl-4,9-bis(oxidanylidene)-1,5-dioxonan-7-yl] 3-methylbutanoate: 45, 49, 53, 386, 393, 396, 400, 447, 461
- binding flavin-adenine dinucleotide: 497
Query Sequence
>Synpcc7942_1718 FitnessBrowser__SynE:Synpcc7942_1718
MPAAATLADWKAASVPDFLAERSRQELARLGNPGWWGPPDLEALAELMQLAAAEGWRILP
AGRGTRLDWGGLGHPVDAVISTAACDRLIEHAAADLTVTVEAGMTLGQLQTILAETGQWL
PFDPIAGESSSLGALVSTGMSGSLRHRYGSLRDFLIGITFLRHDGQWAKGGGRVVKNVAG
YDMMKLLHGAWGSLGLIGKLTFRTYPLPNAWGTIACQGDREAILQLRSQLVRSDLTPVAF
DLLSPAAAAELELRSQWTVLLRFGSVAASVQEQQQVVELQATRLGLAAMTVAEPVWGQLN
QSFEPRSRSATLIKFALLPSQLPCLLAELEAIAPTALGRVHAASGAGWLVWPEAEPTVET
LLRLRRHCEVAEGFLSVLAASVSLKQQLDIWGYPGQGLAVMRAIKRQFDPQSRLAPGRFL
AGLEE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory