Comparing Synpcc7942_1763 FitnessBrowser__SynE:Synpcc7942_1763 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q6NPM8 Bifunctional phosphatase IMPL2, chloroplastic; Histidinol-phosphatase; Histidinol-phosphate phosphatase; HPP; Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Protein HISTIDINE BIOSYNTHESIS 7; Protein MYO-INOSITOL MONOPHOSPHATASE-LIKE 2; EC 3.1.3.15; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 75% coverage: 34:236/272 of query aligns to 112:312/346 of Q6NPM8
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 39% coverage: 28:132/272 of query aligns to 30:138/271 of Q9M8S8
2p3nA Thermotoga maritima impase tm1415 (see paper)
26% identity, 81% coverage: 16:235/272 of query aligns to 10:223/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
26% identity, 81% coverage: 16:235/272 of query aligns to 10:223/256 of O33832
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
37% identity, 38% coverage: 17:120/272 of query aligns to 11:118/258 of 3lv0A
Sites not aligning to the query:
5eq8A Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol (see paper)
28% identity, 71% coverage: 38:229/272 of query aligns to 30:222/259 of 5eq8A
5eq9B Crystal structure of medicago truncatula histidinol-phosphate phosphatase (mthpp) in complex with l-histidinol phosphate and mg2+ (see paper)
28% identity, 71% coverage: 38:229/272 of query aligns to 31:223/260 of 5eq9B
5t3jA Histidinol phosphate phosphatase(hpp) soaked with selenourea for 10 min (see paper)
28% identity, 70% coverage: 40:229/272 of query aligns to 30:220/257 of 5t3jA
Sites not aligning to the query:
4g61A Crystal structure of impase/NADP phosphatase complexed with mg2+ and phosphate (see paper)
26% identity, 84% coverage: 7:234/272 of query aligns to 3:229/264 of 4g61A
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
25% identity, 82% coverage: 27:248/272 of query aligns to 30:255/277 of P20456
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
25% identity, 82% coverage: 27:248/272 of query aligns to 28:253/274 of 2bjiA
5eygB Crystal structure of impase/NADP phosphatase complexed with NADP and ca2+ (see paper)
26% identity, 84% coverage: 7:234/272 of query aligns to 4:230/265 of 5eygB
5f24A Crystal structure of dual specific impase/NADP phosphatase bound with d-inositol-1-phosphate (see paper)
26% identity, 84% coverage: 7:234/272 of query aligns to 3:225/260 of 5f24A
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
40% identity, 33% coverage: 31:120/272 of query aligns to 8:106/238 of 3luzA
Sites not aligning to the query:
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
24% identity, 78% coverage: 31:241/272 of query aligns to 29:240/267 of P0ADG4
Sites not aligning to the query:
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
24% identity, 78% coverage: 31:241/272 of query aligns to 29:240/262 of 2qflA
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
24% identity, 78% coverage: 31:241/272 of query aligns to 33:244/270 of 6ib8B
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
25% identity, 88% coverage: 11:248/272 of query aligns to 14:251/266 of 1imdA
6zk0AAA human impase with ebselen (see paper)
25% identity, 88% coverage: 11:248/272 of query aligns to 15:252/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
25% identity, 88% coverage: 11:248/272 of query aligns to 16:253/274 of 4as4A
>Synpcc7942_1763 FitnessBrowser__SynE:Synpcc7942_1763
MNQPDWRSLAQTIEALCQEVGDRLLLEFGTLQATEKADGSLITAADRWADQTLCDRLSQL
FPKHALLTEESQQTFGGADWTWVVDPLDGTTNFAQGIPIWGISLALLYRGWPVFGAIALP
PLQRFYCGVDTRSTDLAPVAWAERNHQPLQLRTESLGSNQLFSLCTRSAIVLQRWSAPFP
CKIRMLGASTANFLTVLEGTTLGALEATPKIWDIAAVWVLAQALGADWRSLAGEQFPLQS
GRDYGSVNWPTLLLARPALQEAFESWAALLTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory