SitesBLAST
Comparing Synpcc7942_1848 Synpcc7942_1848 aspartate-semialdehyde dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
47% identity, 94% coverage: 10:343/354 of query aligns to 1:342/346 of Q04797
- S98 (= S107) modified: Phosphoserine
- Y146 (≠ H155) modified: Phosphotyrosine
4r54A Complex crystal structure of sp-aspartate-semialdehyde-dehydrogenase with 3-carboxy-ethyl-phthalic acid (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/357 of 4r54A
- binding 3-(2-carboxyethyl)benzene-1,2-dicarboxylic acid: G72 (= G84), S73 (≠ G85), T94 (≠ S106), S95 (= S107), R98 (= R110), K222 (= K223)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), T10 (= T22), G11 (= G23), A12 (= A24), V13 (= V25), A35 (= A47), S36 (= S48), R38 (= R50), S39 (= S51), T56 (≠ A68), S70 (= S82), A71 (= A83), G72 (= G84), T75 (= T87), N93 (= N105), T94 (≠ S106), N126 (= N138), C127 (= C139), G160 (= G172), G328 (= G329)
4r41A Complex crystal structure of 4-nitro-2-phosphono-benzoic acid with sp- aspartate-semialdehyde dehydrogenase and nicotinamide-dinucleotide (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/357 of 4r41A
- binding 4-nitro-2-phosphonobenzoic acid: S70 (= S82), G72 (= G84), S73 (≠ G85), N93 (= N105), T94 (≠ S106), S95 (= S107), R98 (= R110), K222 (= K223)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), T10 (= T22), G11 (= G23), A12 (= A24), A35 (= A47), S36 (= S48), R38 (= R50), S39 (= S51), T56 (≠ A68), A71 (= A83), G160 (= G172), M161 (≠ A173), G162 (≠ R174)
4r3nA Crystal structure of the ternary complex of sp-asadh with NADP and 1, 2,3-benzenetricarboxylic acid (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/357 of 4r3nA
- active site: C127 (= C139), Q154 (= Q166), R244 (= R245), H251 (= H252)
- binding benzene-1,2,3-tricarboxylic acid: S73 (≠ G85), T94 (≠ S106), S95 (= S107), R98 (= R110), N126 (= N138), K222 (= K223)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), T10 (= T22), G11 (= G23), A12 (= A24), V13 (= V25), A35 (= A47), S36 (= S48), S39 (= S51), T56 (≠ A68), S70 (= S82), A71 (= A83), G72 (= G84), N93 (= N105), T94 (≠ S106), N126 (= N138), C127 (= C139), G160 (= G172), M161 (≠ A173), G328 (= G329)
3q1lA Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with cysteamine bound covalently to cys 128 (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/357 of 3q1lA
3pwsA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/357 of 3pwsA
- binding (2R)-2-aminohexanedioic acid: R98 (= R110), N126 (= N138), G158 (= G170), I208 (≠ N209), E219 (= E220), K222 (= K223), R244 (= R245)
- binding adenosine-2'-5'-diphosphate: G8 (= G20), T10 (= T22), G11 (= G23), A12 (= A24), A35 (= A47), S36 (= S48), R38 (= R50), S39 (= S51), T56 (≠ A68), A71 (= A83), T75 (= T87), G160 (= G172), M161 (≠ A173)
3pwkA Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with 2',5'-adenosine diphosphate and d-2- aminoadipate (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/357 of 3pwkA
- binding 5'-o-monophosphoryladenylyl(2'->5')adenylyl(2'->5')adenosine: G8 (= G20), T10 (= T22), G11 (= G23), A12 (= A24), A35 (= A47), S36 (= S48), R38 (= R50), S39 (= S51), T56 (≠ A68), A71 (= A83), T75 (= T87), G160 (= G172)
- binding trans-cyclohexane-1,4-dicarboxylic acid: R98 (= R110), N126 (= N138), G158 (= G170), A159 (= A171), E219 (= E220), K222 (= K223), R244 (= R245)
2gz3A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP and aspartate- semialdehyde (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/357 of 2gz3A
- active site: C127 (= C139), Q154 (= Q166), R244 (= R245), H251 (= H252)
- binding (2r)-2-amino-4-oxobutanoic acid: C127 (= C139), Q154 (= Q166), G158 (= G170), E219 (= E220), R244 (= R245), H251 (= H252)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), T10 (= T22), G11 (= G23), A12 (= A24), V13 (= V25), A35 (= A47), S36 (= S48), R38 (= R50), S39 (= S51), T56 (≠ A68), S70 (= S82), A71 (= A83), G72 (= G84), T75 (= T87), N93 (= N105), G158 (= G170), G160 (= G172), M161 (≠ A173), N324 (≠ Q325), A329 (= A330)
2gz2A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with 2',5'-adp (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/357 of 2gz2A
- active site: C127 (= C139), Q154 (= Q166), R244 (= R245), H251 (= H252)
- binding adenosine-2'-5'-diphosphate: G8 (= G20), T10 (= T22), G11 (= G23), A35 (= A47), S36 (= S48), R38 (= R50), S39 (= S51), T56 (≠ A68), A71 (= A83), T75 (= T87)
2gz1A Structure of aspartate semialdehyde dehydrogenase (asadh) from streptococcus pneumoniae complexed with NADP (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/357 of 2gz1A
- active site: C127 (= C139), Q154 (= Q166), R244 (= R245), H251 (= H252)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), T10 (= T22), G11 (= G23), A12 (= A24), V13 (= V25), A35 (= A47), S36 (= S48), R38 (= R50), S39 (= S51), T56 (≠ A68), S70 (= S82), A71 (= A83), G72 (= G84), T75 (= T87), N93 (= N105), S157 (= S169), G158 (= G170), G160 (= G172), M161 (≠ A173), N324 (≠ Q325), L325 (≠ I326)
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/361 of 3pylC
3q11A Crystals structure of aspartate beta-semialdehyde dehydrogenase from streptococcus pneumoniae with NADP and aspartyl beta- difluorophosphonate (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/358 of 3q11A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), T10 (= T22), G11 (= G23), A35 (= A47), S36 (= S48), R38 (= R50), S39 (= S51), T56 (≠ A68), A71 (= A83), T75 (= T87), G160 (= G172), M161 (≠ A173), G162 (≠ R174)
- binding 5,5-difluoro-4-oxo-5-phosphono-D-norvaline: R98 (= R110), N126 (= N138), C127 (= C139), Q154 (= Q166), G158 (= G170), E219 (= E220), K222 (= K223), R244 (= R245)
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), T10 (= T22), G11 (= G23), A12 (= A24), V13 (= V25), A35 (= A47), S36 (= S48), S39 (= S51), T56 (≠ A68), S70 (= S82), A71 (= A83), G72 (= G84), N93 (= N105), T94 (≠ S106), N126 (= N138), C127 (= C139), G160 (= G172), M161 (≠ A173), G328 (= G329)
- binding phthalic acid: S73 (≠ G85), T94 (≠ S106), S95 (= S107), R98 (= R110), N126 (= N138), K222 (= K223)
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ G85), T94 (≠ S106), S95 (= S107), R98 (= R110), N126 (= N138), C127 (= C139), Q154 (= Q166), G158 (= G170), K222 (= K223), R244 (= R245), H251 (= H252)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), T10 (= T22), G11 (= G23), A12 (= A24), V13 (= V25), A35 (= A47), S36 (= S48), R38 (= R50), S39 (= S51), T56 (≠ A68), S70 (= S82), A71 (= A83), G72 (= G84), T75 (= T87), N93 (= N105), T94 (≠ S106), P125 (= P137), N126 (= N138), C127 (= C139), G160 (= G172), M161 (≠ A173), G328 (= G329)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (≠ S106), S95 (= S107), R98 (= R110), N126 (= N138), C127 (= C139), Q154 (= Q166), G158 (= G170), E219 (= E220), K222 (= K223), R244 (= R245), H251 (= H252)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), T10 (= T22), G11 (= G23), A12 (= A24), V13 (= V25), A35 (= A47), S36 (= S48), R38 (= R50), S39 (= S51), T56 (≠ A68), S70 (= S82), A71 (= A83), G72 (= G84), T75 (= T87), N93 (= N105), T94 (≠ S106), N126 (= N138), C127 (= C139), G160 (= G172), M161 (≠ A173), G328 (= G329)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
48% identity, 96% coverage: 13:351/354 of query aligns to 1:350/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (= R110), G158 (= G170), E219 (= E220), K222 (= K223), R244 (= R245)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G20), T10 (= T22), G11 (= G23), A12 (= A24), V13 (= V25), A35 (= A47), S36 (= S48), R38 (= R50), S39 (= S51), T56 (≠ A68), S70 (= S82), A71 (= A83), G72 (= G84), T75 (= T87), C127 (= C139), S157 (= S169), G158 (= G170), G160 (= G172), M161 (≠ A173), N324 (≠ Q325), L325 (≠ I326)
P23247 Aspartate-semialdehyde dehydrogenase 2; ASA dehydrogenase 2; ASADH 2; Aspartate-beta-semialdehyde dehydrogenase 2; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
46% identity, 94% coverage: 10:343/354 of query aligns to 1:334/337 of P23247
- C132 (= C139) active site, Acyl-thioester intermediate
2r00C Crystal structure of aspartate semialdehyde dehydrogenase ii complexed with asa from vibrio cholerae (see paper)
46% identity, 94% coverage: 11:343/354 of query aligns to 1:333/336 of 2r00C
3tz6A Crystal structure of aspartate semialdehyde dehydrogenase complexed with inhibitor smcs (cys) and phosphate from mycobacterium tuberculosis h37rv (see paper)
45% identity, 93% coverage: 13:341/354 of query aligns to 1:340/342 of 3tz6A
- active site: C129 (= C139), Q156 (= Q166), R248 (= R245), H255 (= H252)
- binding cysteine: C129 (= C139), Q156 (= Q166), G160 (= G170), E223 (= E220), R248 (= R245), H255 (= H252)
- binding glycerol: S108 (≠ P120), G187 (vs. gap), F192 (vs. gap), P201 (= P200), Q225 (≠ L222), R228 (≠ L225), F229 (≠ N226), Q335 (= Q336), E338 (= E339), L339 (= L340)
- binding sulfate ion: R98 (= R110), H117 (≠ Q129), R119 (vs. gap), N128 (= N138), C129 (= C139), K226 (= K223), E270 (≠ A267), R273 (= R270)
4r5mA Crystal structure of vc-aspartate beta-semialdehyde-dehydrogenase with NADP and 4-nitro-2-phosphono-benzoic acid (see paper)
29% identity, 90% coverage: 15:331/354 of query aligns to 2:356/369 of 4r5mA
- active site: C134 (= C139), Q161 (= Q166), R267 (= R245), H274 (= H252)
- binding 4-nitro-2-phosphonobenzoic acid: C71 (≠ S82), G73 (= G84), G74 (= G85), A96 (≠ N105), A97 (≠ S106), S98 (= S107), R101 (= R110), K243 (= K223)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G7 (= G20), R9 (≠ T22), G10 (= G23), M11 (≠ A24), V12 (= V25), T36 (≠ S48), S37 (≠ P49), Q72 (≠ A83), G73 (= G84), G165 (= G170)
Query Sequence
>Synpcc7942_1848 Synpcc7942_1848 aspartate-semialdehyde dehydrogenase
MLFGVRRLSLSQGYRVAILGATGAVGTELLQILEERQFPIAELRLLASPRSAGQTLTFAG
ETLTIQEATPSAFQGLDIVLASAGGSTSKALAEAIVAAGAVMIDNSSAFRMDPTVPLVVP
EVNPEAAAQHQGIIANPNCTTILMAIALWPLQQRHPIRRIVVSTYQSASGAGARAMAEVQ
EQSRAILAGQPAIAEILPYPLAFNLFPHNSPLTESGYCEEELKMLNESRKIFGLPDLKLT
ATCVRVPVLRAHSEAINVEFTEPFSVAEAREAIAAAPGARLLEDWDRNYFPMPIEASGED
DVLVGRIRQDLSEPNALELWICGDQIRKGAALNAVQIAELLVKRQWLRSPALTH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory