Comparing Synpcc7942_1861 FitnessBrowser__SynE:Synpcc7942_1861 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
26% identity, 86% coverage: 35:396/421 of query aligns to 2:324/350 of 3td9A
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
25% identity, 90% coverage: 35:412/421 of query aligns to 3:342/345 of 4n0qB
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
29% identity, 58% coverage: 42:286/421 of query aligns to 10:243/348 of 3ipcA
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
29% identity, 58% coverage: 42:286/421 of query aligns to 10:243/348 of 3ip9A
Sites not aligning to the query:
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
29% identity, 58% coverage: 42:286/421 of query aligns to 10:243/348 of 3ip7A
Sites not aligning to the query:
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
29% identity, 58% coverage: 42:286/421 of query aligns to 10:243/348 of 3ip6A
Sites not aligning to the query:
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
29% identity, 58% coverage: 42:286/421 of query aligns to 10:243/348 of 3ip5A
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
26% identity, 61% coverage: 35:291/421 of query aligns to 3:248/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
26% identity, 61% coverage: 35:291/421 of query aligns to 3:248/344 of 1z17A
Sites not aligning to the query:
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
26% identity, 61% coverage: 35:291/421 of query aligns to 3:248/344 of 1z16A
Sites not aligning to the query:
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
25% identity, 76% coverage: 35:354/421 of query aligns to 3:306/348 of 4gnrA
1uskA L-leucine-binding protein with leucine bound (see paper)
26% identity, 61% coverage: 35:290/421 of query aligns to 3:247/345 of 1uskA
Sites not aligning to the query:
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
26% identity, 61% coverage: 35:290/421 of query aligns to 3:247/345 of 1usiA
Sites not aligning to the query:
6bt5A Human mglu8 receptor complexed with l-ap4 (see paper)
24% identity, 75% coverage: 97:411/421 of query aligns to 81:410/442 of 6bt5A
Sites not aligning to the query:
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
34% identity, 33% coverage: 59:195/421 of query aligns to 23:154/335 of 4q6bA
Sites not aligning to the query:
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
34% identity, 33% coverage: 59:195/421 of query aligns to 23:154/336 of 4mlcA
Sites not aligning to the query:
6bszA Human mglu8 receptor complexed with glutamate (see paper)
24% identity, 74% coverage: 102:411/421 of query aligns to 87:411/445 of 6bszA
Sites not aligning to the query:
P47743 Metabotropic glutamate receptor 8; mGluR8 from Mus musculus (Mouse) (see paper)
23% identity, 74% coverage: 101:411/421 of query aligns to 145:481/908 of P47743
Sites not aligning to the query:
6e5vB Human mglu8 receptor amino terminal domain in complex with (s)-3,4- dicarboxyphenylglycine (dcpg) (see paper)
24% identity, 74% coverage: 97:406/421 of query aligns to 86:419/447 of 6e5vB
Sites not aligning to the query:
8jd54 Cryo-em structure of gi1-bound mglu2-mglu4 heterodimer (see paper)
22% identity, 77% coverage: 93:415/421 of query aligns to 79:416/765 of 8jd54
Sites not aligning to the query:
>Synpcc7942_1861 FitnessBrowser__SynE:Synpcc7942_1861
MMQRSRSACVALMSTVLLVSCQTQVQWPWQDPGGLKLGSLLPLTGDLAQYGRPMQDTAEL
LVQTVNACGGVQGLPVRLIPADDETKPDRGVAAMTKLAEVDRVAGVVGAAASNVSDAALT
LAVNNRVVMISPSSTSPRFTERARRGDFKGYWFRTAPSDALQGPALAKLALDQGWRSVSV
IAINNDYGNGLLRSFIPAFEQAGGVVFNRDQPVLYTPDASSFDSEVEQVFRDRPDAVVLI
GYPDSGALILKSAYEKGLLGQSTQMLLTDGLKTDQLAELVGRNPQGRYIVQDLVGVAPSS
GGPGREAFLKRYQERFQRSPQVFDANTWDAAALLVLAAEKSKSLEGEKLKDSVAAIANGP
GEPVSDICQALALVRAGKPINYQGASSELKLDNNGDVSGRYDFWQFDADGKVKILKTESF
Q
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory