Comparing Synpcc7942_1961 Synpcc7942_1961 ferripyochelin binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2fkoA Structure of ph1591 from pyrococcus horikoshii ot3 (see paper)
48% identity, 86% coverage: 11:167/182 of query aligns to 10:168/173 of 2fkoA
1v3wA Structure of ferripyochelin binding protein from pyrococcus horikoshii ot3 (see paper)
48% identity, 86% coverage: 11:167/182 of query aligns to 10:168/173 of 1v3wA
7zw9A Crystal structure of a gamma-carbonic anhydrase from the pathogenic bacterium burkholderia pseudomallei (see paper)
49% identity, 87% coverage: 12:169/182 of query aligns to 11:169/173 of 7zw9A
6iveA Molecular structure of a thermostable and a zinc ion binding gamma- class carbonic anhydrase (see paper)
49% identity, 90% coverage: 4:167/182 of query aligns to 5:161/168 of 6iveA
Q5KW03 Carbonic anhydrase; Gamma-carbonic anhydrase; Cag; EC 4.2.1.1 from Geobacillus kaustophilus (strain HTA426) (see paper)
41% identity, 90% coverage: 12:174/182 of query aligns to 10:174/182 of Q5KW03
3vnpA Crystal structure of hypothetical protein (gk2848) from geobacillus kaustophilus
41% identity, 87% coverage: 12:169/182 of query aligns to 11:170/171 of 3vnpA
4n27A X-ray structure of brucella abortus rica (see paper)
44% identity, 80% coverage: 15:159/182 of query aligns to 16:162/175 of 4n27A
3tioF Crystal structures of yrda from escherichia coli, a homologous protein of gamma-class carbonic anhydrase, show possible allosteric conformations (see paper)
39% identity, 86% coverage: 12:168/182 of query aligns to 11:176/177 of 3tioF
3r3rA Structure of the yrda ferripyochelin binding protein from salmonella enterica
41% identity, 87% coverage: 12:169/182 of query aligns to 16:182/184 of 3r3rA
8e73G2 qcr9 (see paper)
38% identity, 93% coverage: 12:180/182 of query aligns to 52:223/258 of 8e73G2
8bpxy Cytochrome b-c1 complex subunit Rieske-1, mitochondrial (see paper)
37% identity, 93% coverage: 12:181/182 of query aligns to 53:230/265 of 8bpxy
Sites not aligning to the query:
8befy Cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci membrane core) (see paper)
37% identity, 93% coverage: 12:181/182 of query aligns to 53:230/265 of 8befy
Sites not aligning to the query:
7ar7y Cryo-em structure of arabidopsis thaliana complex-i (open conformation) (see paper)
37% identity, 93% coverage: 12:181/182 of query aligns to 52:229/268 of 7ar7y
Sites not aligning to the query:
7aqqy Cryo-em structure of arabidopsis thaliana complex-i (membrane core) (see paper)
37% identity, 93% coverage: 12:181/182 of query aligns to 52:229/268 of 7aqqy
7aqqz Cryo-em structure of arabidopsis thaliana complex-i (membrane core) (see paper)
39% identity, 87% coverage: 12:170/182 of query aligns to 52:218/233 of 7aqqz
Sites not aligning to the query:
7a23p Plant mitochondrial respiratory complex i (see paper)
39% identity, 87% coverage: 12:170/182 of query aligns to 48:214/224 of 7a23p
Sites not aligning to the query:
6sc4B Gamma-carbonic anhydrase from the haloarchaeon halobacterium sp. (see paper)
35% identity, 87% coverage: 11:168/182 of query aligns to 10:177/178 of 6sc4B
3ixcA Crystal structure of hexapeptide transferase family protein from anaplasma phagocytophilum
36% identity, 85% coverage: 12:165/182 of query aligns to 13:165/166 of 3ixcA
8gpmA Acinetobacter baumannii carbonic anhydrase
42% identity, 80% coverage: 19:163/182 of query aligns to 18:164/193 of 8gpmA
8gppA Acinetobacter baumannii carbonic anhydrase paay
42% identity, 80% coverage: 19:163/182 of query aligns to 17:163/189 of 8gppA
>Synpcc7942_1961 Synpcc7942_1961 ferripyochelin binding protein
MAAFGDRTWGEPDCQRATYVAESAVICGDVVLAEGVSIWPTAVLRGDVERIEIGCNSNVQ
DGAVLHGDPGQPTILEEDVTVGHRAVIHSANIGAGSLIGIGAIVLNGVQIGAGSIVGAGA
VVTKSIPAGSLAMGVPAKVVRSLSAAEIADLRQHAQHYVALAEAHAQQQAGKTSEKRSES
AQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory