Comparing Synpcc7942_1971 FitnessBrowser__SynE:Synpcc7942_1971 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
45% identity, 91% coverage: 20:248/252 of query aligns to 9:237/380 of P54955
Sites not aligning to the query:
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
42% identity, 94% coverage: 12:247/252 of query aligns to 7:242/389 of 4ewtA
Sites not aligning to the query:
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 92% coverage: 18:248/252 of query aligns to 45:277/442 of P54968
Sites not aligning to the query:
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 89% coverage: 24:248/252 of query aligns to 51:273/440 of O04373
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
42% identity, 90% coverage: 23:249/252 of query aligns to 21:248/398 of 6slfA
Sites not aligning to the query:
>Synpcc7942_1971 FitnessBrowser__SynE:Synpcc7942_1971
LLVCPVLDRIREVATRLEPRLLEIRRHLHAHPELSGHEHQTAAYVAGVLSSCGLQVREGV
GRTGVVGDLPGTGRDRRCLALRTDMDALPIEEQTGLPFASRQQGIMHACGHDLHTTLGLG
AAMVLSELGEPLPGDVRWLFQPAEEIAQGARWMVAAEALEGVDAILGVHVFPSIPAGVVG
IRYGALTAAADDLEIVIQGESGHGARPHEAKDAIWIAAQIITMLQQAISRTQNPLRPVVL
TIGQIQGGELLM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory