SitesBLAST
Comparing Synpcc7942_2078 FitnessBrowser__SynE:Synpcc7942_2078 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ij6A Crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from hydrogenobacter thermophilus tk-6 in complex with l-phosphoserine (see paper)
30% identity, 95% coverage: 2:202/212 of query aligns to 1:200/207 of 4ij6A
- active site: R8 (= R9), A9 (≠ H10), N15 (≠ S16), R58 (= R59), E82 (= E83), H150 (= H151)
- binding phosphoserine: R8 (= R9), Q21 (≠ S22), R58 (= R59), E82 (= E83), H85 (≠ F86), H150 (= H151), T151 (≠ K152)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
30% identity, 93% coverage: 5:202/212 of query aligns to 4:201/207 of 1h2fA
- active site: R8 (= R9), H9 (= H10), N15 (≠ S16), R58 (= R59), E82 (= E83), H150 (= H151)
- binding phosphate ion: G142 (≠ D143), E143 (≠ G144)
- binding trivanadate: R8 (= R9), H9 (= H10), N15 (≠ S16), Q21 (≠ S22), R58 (= R59), E82 (= E83), H150 (= H151), G151 (≠ K152), V152 (≠ A153)
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
30% identity, 93% coverage: 5:202/212 of query aligns to 4:201/207 of 1h2eA
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
25% identity, 94% coverage: 4:202/212 of query aligns to 3:196/196 of 6m1xC
5htkA Human heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
32% identity, 75% coverage: 5:163/212 of query aligns to 222:373/425 of 5htkA
- active site: R226 (= R9), H227 (= H10), N233 (≠ S16), R276 (= R59), E296 (≠ R76), H361 (= H151)
- binding 6-O-phosphono-beta-D-fructofuranose: H227 (= H10), I238 (≠ Y21), G239 (≠ S22), E296 (≠ R76), Y307 (≠ F86), R321 (≠ S100), K325 (≠ D104), Y336 (≠ A123), Q362 (≠ K152), R366 (= R156)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 17, 18, 19, 20, 21, 22, 140, 144, 145, 146, 397, 398
- binding citrate anion: 48, 61, 72, 99, 100, 167
1bifA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase bifunctional enzyme complexed with atp-g-s and phosphate (see paper)
29% identity, 75% coverage: 5:163/212 of query aligns to 215:366/432 of 1bifA
- active site: R219 (= R9), H220 (= H10), N226 (≠ S16), R269 (= R59), E289 (= E83), H354 (= H151)
- binding phosphate ion: R219 (= R9), H220 (= H10), R269 (= R59), E289 (= E83), Y300 (≠ P94), R314 (≠ W108), K318 (≠ P112), Y329 (≠ A123), H354 (= H151), R359 (= R156)
Sites not aligning to the query:
- binding phosphothiophosphoric acid-adenylate ester: 11, 12, 13, 14, 15, 16, 17, 131, 134, 136, 184, 210, 391
Q7ZVE3 Fructose-2,6-bisphosphatase TIGAR B; TP53-induced glycolysis and apoptosis regulator B; EC 3.1.3.46 from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
28% identity, 66% coverage: 1:139/212 of query aligns to 2:141/257 of Q7ZVE3
- H11 (= H10) active site, Tele-phosphohistidine intermediate
2axnA Crystal structure of the human inducible form 6-phosphofructo-2- kinase/fructose-2,6-bisphosphatase (see paper)
30% identity, 75% coverage: 5:163/212 of query aligns to 244:395/451 of 2axnA
- active site: R248 (= R9), H249 (= H10), N255 (≠ S16), S298 (≠ R59), E318 (= E83), H383 (= H151)
- binding 6-O-phosphono-beta-D-fructofuranose: I260 (≠ Y21), G261 (≠ S22), E318 (= E83), Y329 (≠ P94), R343 (≠ H107), K347 (≠ E111), Y358 (≠ A123), Q384 (≠ K152), R388 (= R156)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 39, 40, 41, 42, 43, 44, 45, 148, 159, 162, 163, 164, 420
- binding {[-(bis-carboxymethyl-amino)-ethyl]-carboxymethyl-amino}-acetic acid: 39, 43, 65, 67, 70, 71, 83, 121, 122, 189
- binding 6-O-phosphono-beta-D-fructofuranose: 436
5ajzA Human pfkfb3 in complex with an indole inhibitor 5 (see paper)
30% identity, 75% coverage: 5:163/212 of query aligns to 243:394/440 of 5ajzA
- active site: R247 (= R9), H248 (= H10), N254 (≠ S16), S297 (≠ R59), E317 (= E83), H382 (= H151)
- binding 6-O-phosphono-beta-D-fructofuranose: G260 (≠ S22), E317 (= E83), Y328 (≠ P94), R342 (≠ H107), K346 (≠ E111), Y357 (≠ A123), Q383 (≠ K152), R387 (= R156)
- binding phosphonic acid: R247 (= R9), H248 (= H10), N254 (≠ S16), H382 (= H151), Q383 (≠ K152)
Sites not aligning to the query:
- binding 2-azanyl-N-[4-[(3-cyano-1H-indol-5-yl)oxy]phenyl]ethanamide: 40, 41, 44, 45, 154, 158, 212, 213, 233, 236, 238
5ajyA Human pfkfb3 in complex with an indole inhibitor 4 (see paper)
30% identity, 75% coverage: 5:163/212 of query aligns to 243:394/439 of 5ajyA
- active site: R247 (= R9), H248 (= H10), N254 (≠ S16), S297 (≠ R59), E317 (= E83), H382 (= H151)
- binding 6-O-phosphono-beta-D-fructofuranose: G260 (≠ S22), E317 (= E83), Y328 (≠ P94), R342 (≠ H107), K346 (≠ E111), Y357 (≠ A123), Q383 (≠ K152), R387 (= R156)
- binding phosphonic acid: R247 (= R9), H248 (= H10), N254 (≠ S16), H382 (= H151), Q383 (≠ K152)
Sites not aligning to the query:
4d4mA Human pfkfb3 in complex with a pyrrolopyrimidone compound
30% identity, 75% coverage: 5:163/212 of query aligns to 243:394/439 of 4d4mA
- active site: R247 (= R9), H248 (= H10), N254 (≠ S16), S297 (≠ R59), E317 (= E83), H382 (= H151)
- binding 6-O-phosphono-beta-D-fructofuranose: G260 (≠ S22), E317 (= E83), Y328 (≠ P94), R342 (≠ H107), K346 (≠ E111), Y357 (≠ A123), Q383 (≠ K152), R387 (= R156)
- binding phosphonic acid: R247 (= R9), H248 (= H10), N254 (≠ S16), H382 (= H151), Q383 (≠ K152)
Sites not aligning to the query:
- binding 7-(4-bromophenyl)-5-phenyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one: 40, 41, 44, 45, 154, 158, 161, 209, 212, 233, 236, 238
2i1vB Crystal structure of pfkfb3 in complex with adp and fructose-2,6- bisphosphate (see paper)
30% identity, 75% coverage: 5:163/212 of query aligns to 244:395/449 of 2i1vB
- binding 6-O-phosphono-beta-D-fructofuranose: I260 (≠ Y21), G261 (≠ S22), E318 (= E83), Y329 (≠ P94), R343 (≠ H107), K347 (≠ E111), Y358 (≠ A123), Q384 (≠ K152), R388 (= R156)
- binding phosphonic acid: R248 (= R9), H249 (= H10), N255 (≠ S16), H383 (= H151)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 39, 40, 41, 42, 43, 44, 45, 159, 163, 164, 213, 420
- binding 2,6-di-O-phosphono-beta-D-fructofuranose: 67, 70, 83, 121, 122, 128, 185, 189
2dwoA Pfkfb3 in complex with adp and pep (see paper)
30% identity, 75% coverage: 5:163/212 of query aligns to 244:395/449 of 2dwoA
- active site: R248 (= R9), H249 (= H10), N255 (≠ S16), S298 (≠ R59), E318 (= E83), H383 (= H151)
- binding 6-O-phosphono-beta-D-fructofuranose: I260 (≠ Y21), G261 (≠ S22), E318 (= E83), Y329 (≠ P94), R343 (≠ H107), K347 (≠ E111), Y358 (≠ A123), Q384 (≠ K152), R388 (= R156)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 39, 40, 41, 42, 43, 44, 45, 148, 159, 162, 163, 164, 239, 420
- binding 6-O-phosphono-beta-D-fructofuranose: 436
- binding phosphoenolpyruvate: 70, 83, 94, 122, 189
5ajxA Human pfkfb3 in complex with an indole inhibitor 3 (see paper)
30% identity, 75% coverage: 5:163/212 of query aligns to 245:396/441 of 5ajxA
- active site: R249 (= R9), H250 (= H10), N256 (≠ S16), S299 (≠ R59), E319 (= E83), H384 (= H151)
- binding 6-O-phosphono-beta-D-fructofuranose: I261 (≠ Y21), G262 (≠ S22), E319 (= E83), Y330 (≠ P94), R344 (≠ H107), K348 (≠ E111), Y359 (≠ A123), Q385 (≠ K152), R389 (= R156)
- binding phosphonic acid: R249 (= R9), H250 (= H10), N256 (≠ S16), H384 (= H151), Q385 (≠ K152)
Sites not aligning to the query:
- binding (2S)-N-[4-[3-cyano-1-[(3,5-dimethyl-1,2-oxazol-4-yl)methyl]indol-5-yl]oxyphenyl]pyrrolidine-2-carboxamide: 42, 43, 46, 47, 211, 214, 215, 218, 235, 236, 238, 240
5ajvB Human pfkfb3 in complex with an indole inhibitor 1 (see paper)
30% identity, 75% coverage: 5:163/212 of query aligns to 238:389/435 of 5ajvB
- binding 2,6-di-O-phosphono-beta-D-fructofuranose: R242 (= R9), H243 (= H10), E312 (= E83), Y323 (≠ P94), R337 (≠ H107), K341 (≠ E111), Y352 (≠ A123), H377 (= H151), Q378 (≠ K152), R382 (= R156)
Sites not aligning to the query:
5ak0A Human pfkfb3 in complex with an indole inhibitor 6 (see paper)
30% identity, 75% coverage: 5:163/212 of query aligns to 245:396/442 of 5ak0A
- active site: R249 (= R9), H250 (= H10), N256 (≠ S16), S299 (≠ R59), E319 (= E83), H384 (= H151)
- binding 6-O-phosphono-beta-D-fructofuranose: G262 (≠ S22), E319 (= E83), Y330 (≠ P94), R344 (≠ H107), K348 (≠ E111), Y359 (≠ A123), Q385 (≠ K152), R389 (= R156)
- binding phosphonic acid: R249 (= R9), H250 (= H10), H384 (= H151), Q385 (≠ K152)
Sites not aligning to the query:
- binding (2s)-n-[4-[1-methyl-3-(1-methylpyrazol-4-yl)indol-5-yl]oxyphenyl]pyrrolidine-2-carboxamide: 42, 46, 47, 149, 159, 161, 214, 215, 218, 235, 236, 238
4d4lA Human pfkfb3 in complex with a pyrrolopyrimidone compound
30% identity, 75% coverage: 5:163/212 of query aligns to 245:396/442 of 4d4lA
- active site: R249 (= R9), H250 (= H10), N256 (≠ S16), S299 (≠ R59), E319 (= E83), H384 (= H151)
- binding 6-O-phosphono-beta-D-fructofuranose: I261 (≠ Y21), G262 (≠ S22), E319 (= E83), Y330 (≠ P94), R344 (≠ H107), K348 (≠ E111), Y359 (≠ A123), Q385 (≠ K152), R389 (= R156)
- binding phosphonic acid: R249 (= R9), H250 (= H10), N256 (≠ S16), H384 (= H151), Q385 (≠ K152)
Sites not aligning to the query:
- binding 5-(4-chlorophenyl)-7-phenyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one: 42, 43, 46, 47, 156, 160, 163, 211, 214, 240
- binding 6-O-phosphono-beta-D-fructofuranose: 437
4d4jA Human pfkfb3 in complex with a pyrrolopyrimidone compound
30% identity, 75% coverage: 5:163/212 of query aligns to 245:396/442 of 4d4jA
- active site: R249 (= R9), H250 (= H10), N256 (≠ S16), S299 (≠ R59), E319 (= E83), H384 (= H151)
- binding 6-O-phosphono-beta-D-fructofuranose: I261 (≠ Y21), G262 (≠ S22), E319 (= E83), Y330 (≠ P94), R344 (≠ H107), K348 (≠ E111), Y359 (≠ A123), Q385 (≠ K152), R389 (= R156)
- binding phosphonic acid: R249 (= R9), H250 (= H10), E319 (= E83), H384 (= H151), Q385 (≠ K152)
Sites not aligning to the query:
- binding 5-(4-bromophenyl)-7-phenyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one: 42, 43, 46, 47, 156, 160, 163, 211, 214, 235, 238, 240
3qpuA Pfkfb3 in complex with ppi (see paper)
30% identity, 75% coverage: 5:163/212 of query aligns to 241:392/439 of 3qpuA
Sites not aligning to the query:
- binding pyrophosphate 2-: 36, 37, 38, 39, 40, 41, 42, 64, 67, 91, 119, 160, 161, 186, 417
6hvjA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 3 (see paper)
30% identity, 75% coverage: 5:163/212 of query aligns to 232:383/430 of 6hvjA
- active site: R236 (= R9), H237 (= H10), N243 (≠ S16), S286 (≠ R59), E306 (= E83), H371 (= H151)
- binding 6-O-phosphono-beta-D-fructofuranose: G249 (≠ S22), E306 (= E83), Y317 (≠ P94), R331 (≠ H107), K335 (≠ E111), Y346 (≠ A123), Q372 (≠ K152), R376 (= R156)
Sites not aligning to the query:
- binding 8-(3-methyl-1-benzofuran-5-yl)-~{N}-(4-methylsulfonylpyridin-3-yl)quinoxalin-6-amine: 29, 33, 34, 136, 138, 143, 147, 151, 198, 225, 407
- binding phosphate ion: 28, 29, 30, 31, 32, 152
Query Sequence
>Synpcc7942_2078 FitnessBrowser__SynE:Synpcc7942_2078
MVLRLYLVRHGETTASREGGYSGSGNPPLTEAGQQMAQALADTYADLNWQAAYVSPMLRA
QETAQPLCQQAKLDMRIRDGLREIDFGIWENRTPDEVMASHQQDYLHWLAEPAWNPPTGG
ESAVVVASRVSLVIQEITETIADGNVLVVSHKATLRILLCNLLGIDLGRYRDRIAMPVAS
LSILSFNQHGPCLERLGDRSHLPLELRDRAGT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory