Comparing Synpcc7942_2111 FitnessBrowser__SynE:Synpcc7942_2111 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2qm1B Crystal structure of glucokinase from enterococcus faecalis
35% identity, 96% coverage: 2:292/302 of query aligns to 3:319/325 of 2qm1B
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
35% identity, 94% coverage: 8:292/302 of query aligns to 4:309/312 of 3vglA
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
35% identity, 94% coverage: 8:292/302 of query aligns to 4:309/312 of 3vgkB
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
31% identity, 61% coverage: 105:289/302 of query aligns to 178:378/396 of 1z05A
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
31% identity, 94% coverage: 9:291/302 of query aligns to 8:304/306 of 7p7wBBB
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
31% identity, 94% coverage: 9:291/302 of query aligns to 5:301/303 of 7p9lAAA
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
31% identity, 94% coverage: 9:291/302 of query aligns to 6:302/304 of 7p9pAAA
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
30% identity, 96% coverage: 8:296/302 of query aligns to 4:289/290 of 6jdbA
3vovB Crystal structure of rok hexokinase from thermus thermophilus (see paper)
35% identity, 97% coverage: 6:297/302 of query aligns to 2:296/298 of 3vovB
2gupA Structural genomics, the crystal structure of a rok family protein from streptococcus pneumoniae tigr4 in complex with sucrose
32% identity, 82% coverage: 6:252/302 of query aligns to 2:241/289 of 2gupA
Sites not aligning to the query:
P32718 D-allose kinase; Allokinase; EC 2.7.1.55 from Escherichia coli (strain K12) (see paper)
29% identity, 96% coverage: 6:296/302 of query aligns to 7:300/309 of P32718
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
30% identity, 95% coverage: 5:291/302 of query aligns to 8:307/311 of 4db3A
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
26% identity, 88% coverage: 30:296/302 of query aligns to 26:305/306 of 5f7rA
Sites not aligning to the query:
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
26% identity, 88% coverage: 30:296/302 of query aligns to 107:389/396 of 5f7qE
Sites not aligning to the query:
3lm9A Crystal structure of fructokinase with adp and fructose bound in the active site (see paper)
28% identity, 96% coverage: 9:298/302 of query aligns to 5:291/294 of 3lm9A
1xc3A Structure of a putative fructokinase from bacillus subtilis (see paper)
28% identity, 96% coverage: 9:298/302 of query aligns to 5:291/295 of 1xc3A
P50456 DNA-binding transcriptional repressor Mlc; Making large colonies protein; Membrane linked control from Escherichia coli (strain K12) (see 4 papers)
25% identity, 78% coverage: 53:289/302 of query aligns to 137:388/406 of P50456
Sites not aligning to the query:
1z6rA Crystal structure of mlc from escherichia coli (see paper)
25% identity, 78% coverage: 53:289/302 of query aligns to 113:364/382 of 1z6rA
Q93LQ8 Beta-glucoside kinase; EC 2.7.1.85 from Klebsiella pneumoniae (see paper)
26% identity, 93% coverage: 7:288/302 of query aligns to 3:281/297 of Q93LQ8
1woqA Crystal structure of inorganic polyphosphate/atp-glucomannokinase from arthrobacter sp. Strain km at 1.8 a resolution (see paper)
31% identity, 86% coverage: 30:289/302 of query aligns to 29:246/253 of 1woqA
Sites not aligning to the query:
>Synpcc7942_2111 FitnessBrowser__SynE:Synpcc7942_2111
MAYPATVIGVDLGGTAMKLGRYTIEGQCQQELTVPTPTPSTPSNVRAALVEAIRQLDPQA
EALAIGIGTPGPADAAGRVARVAINLDGWTEVPLADWLEADLQRPVILANDANCAGLGEV
WLGGGRGYRDAILLTLGTGVGGAIVLNGELFVGRTGTAAELGLITLDPAGPHCNSGNQGS
LEQYASIGAVQRRFGCDPKDLGDRASQGDPEAIAAWQDYGRTLAAGLASLVYVLTPEVII
LGGGISGSAAFFLPALTEELHRRVLPTSREDLQIAIAALGNEAGRVGAAKLAWDKLQALG
KV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory