SitesBLAST
Comparing Synpcc7942_2123 FitnessBrowser__SynE:Synpcc7942_2123 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5nofA Anthranilate phosphoribosyltransferase from thermococcus kodakaraensis (see paper)
40% identity, 96% coverage: 14:348/348 of query aligns to 3:325/325 of 5nofA
1kgzB Crystal structure analysis of the anthranilate phosphoribosyltransferase from erwinia carotovora (current name, pectobacterium carotovorum) (see paper)
39% identity, 96% coverage: 12:344/348 of query aligns to 3:329/330 of 1kgzB
- binding manganese (ii) ion: S92 (= S103), D222 (= D236), E223 (= E237), E223 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V79 (≠ C90), G82 (= G93), G83 (= G94), N90 (= N101), I91 (= I102), S92 (= S103), T93 (= T104), K108 (= K119), S118 (= S131)
1zxyA Anthranilate phosphoribosyltransferase from sulfolobus solfataricus in complex with prpp and magnesium (see paper)
36% identity, 95% coverage: 14:344/348 of query aligns to 6:328/344 of 1zxyA
- binding magnesium ion: D223 (= D236), E224 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: A78 (≠ C90), G79 (= G91), D83 (= D95), T87 (= T99), N89 (= N101), S91 (= S103), T92 (= T104), K106 (= K119), S118 (= S131), D223 (= D236), E224 (= E237)
2gvqD Anthranilate phosphoribosyl-transferase (trpd) from s. Solfataricus in complex with anthranilate (see paper)
36% identity, 95% coverage: 14:344/348 of query aligns to 6:328/345 of 2gvqD
P50384 Anthranilate phosphoribosyltransferase; EC 2.4.2.18 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 2 papers)
36% identity, 95% coverage: 14:344/348 of query aligns to 6:328/345 of P50384
- T87 (= T99) binding
- K106 (= K119) mutation to Q: Affinity for phosphoribosylpyrophosphate is similar to that of the wild-type enzyme and catalytic efficiency dedreases only 10-fold.
- H107 (= H120) mutation to A: Limited effect on either affinity for anthranilate and catalytic efficiency. 300-fold decrease of the affinity for anthranilate, whereas catalytic efficiency remains nearly unchanged; when associated with A-178.
- S118 (= S131) binding
- H154 (= H167) mutation to A: Limited effect on either affinity for anthranilate and catalytic efficiency.
- R164 (= R177) mutation to A: Strong decrease of the affinity for anthranilate, although only a moderate 7-fold decrease in catalytic efficiency.
- D223 (= D236) mutation to N: Affinity for phosphoribosylpyrophosphate is similar to that of the wild-type enzyme and catalytic efficiency is unchanged.
- E224 (= E237) mutation to Q: Affinity for phosphoribosylpyrophosphate is similar to that of the wild-type enzyme and catalytic efficiency is unchanged.
4yi7A Anthranilate bound at active site of anthranilate phosphoribosyl transferase from acinetobacter (anprt; trpd)
35% identity, 96% coverage: 15:348/348 of query aligns to 4:328/331 of 4yi7A
1gxbA Anthranilate phosphoribosyltransferase in complex with pyrophosphate and magnesium (see paper)
35% identity, 95% coverage: 14:344/348 of query aligns to 6:324/339 of 1gxbA
3gbrA Anthranilate phosphoribosyl-transferase (trpd) double mutant d83g f149s from s. Solfataricus (see paper)
35% identity, 95% coverage: 14:344/348 of query aligns to 6:325/341 of 3gbrA
- binding manganese (ii) ion: S91 (= S103), D220 (= D236), E221 (= E237), E221 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: A78 (≠ C90), G79 (= G91), T80 (= T92), G81 (= G93), N89 (= N101), V90 (≠ I102), S91 (= S103), T92 (= T104), K106 (= K119), G114 (= G127)
4n93A Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase (see paper)
38% identity, 95% coverage: 14:345/348 of query aligns to 7:342/346 of 4n93A
- active site: V83 (≠ C90)
- binding 2-amino-6-methylbenzoic acid: V83 (≠ C90), G84 (= G91), T85 (= T92), H113 (= H120), N115 (= N122), N115 (= N122), A156 (= A163), P157 (= P164), H160 (= H167), Y163 (≠ M170), A167 (= A174), R170 (= R177), G183 (= G190), P184 (= P191)
- binding magnesium ion: S96 (= S103), D228 (= D236), E229 (= E237), E229 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G91), G86 (= G93), G87 (= G94), N94 (= N101), S96 (= S103), T97 (= T104), K112 (= K119), A117 (≠ S124), A118 (= A125), S120 (≠ G127), G123 (= G130)
4n5vA Alternative substrates of mycobacterium tuberculosis anthranilate phosphoribosyl transferase (see paper)
38% identity, 95% coverage: 14:345/348 of query aligns to 8:343/347 of 4n5vA
- active site: V84 (≠ C90)
- binding 2-amino-4-fluorobenzoic acid: V84 (≠ C90), G85 (= G91), H114 (= H120), G115 (= G121), N116 (= N122), A157 (= A163), A157 (= A163), P158 (= P164), H161 (= H167), Y164 (≠ M170), R165 (≠ K171), A168 (= A174), R171 (= R177), G184 (= G190)
- binding magnesium ion: S97 (= S103), D229 (= D236), E230 (= E237), E230 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G85 (= G91), G87 (= G93), G88 (= G94), N95 (= N101), S97 (= S103), T98 (= T104), K113 (= K119), A119 (= A125), S120 (= S126), S121 (≠ G127), G124 (= G130)
4zokA Methylsulfonyl-containing inhibitor bound in the substrate capture site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
38% identity, 95% coverage: 14:345/348 of query aligns to 6:339/342 of 4zokA
- active site: V82 (≠ C90)
- binding 4-methyl-2-{[2-methyl-6-(methylsulfonyl)phenyl]amino}benzoic acid: P156 (= P164), R163 (≠ K171), A166 (= A174), A167 (≠ P175)
- binding magnesium ion: S95 (= S103), E228 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G86 (= G94), N93 (= N101), S95 (= S103), T96 (= T104), K111 (= K119), A116 (≠ S124), A117 (= A125), S119 (≠ G127), G122 (= G130)
4zofA Lobenzarit-like inhibitor bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
38% identity, 95% coverage: 14:345/348 of query aligns to 6:339/342 of 4zofA
- active site: V82 (≠ C90)
- binding 2-[(2-carboxy-5-nitrophenyl)amino]-3-methylbenzoic acid: G113 (= G121), N114 (= N122), A155 (= A163), H159 (= H167), Y162 (≠ M170), R169 (= R177), G182 (= G190)
- binding magnesium ion: S95 (= S103), D227 (= D236), E228 (= E237), E228 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G91), G85 (= G93), G86 (= G94), N93 (= N101), S95 (= S103), T96 (= T104), K111 (= K119), A116 (≠ S124), A117 (= A125), S119 (≠ G127), G122 (= G130)
3r88B Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs145) (see paper)
38% identity, 95% coverage: 14:345/348 of query aligns to 6:340/344 of 3r88B
- active site: V82 (≠ C90)
- binding 2-amino-4,5-dimethoxybenzoic acid: N114 (= N122), A155 (= A163), P156 (= P164), H159 (= H167), Y162 (≠ M170), R163 (≠ K171), A166 (= A174)
- binding magnesium ion: S95 (= S103), D227 (= D236), E228 (= E237), E228 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V82 (≠ C90), G83 (= G91), G85 (= G93), G86 (= G94), N93 (= N101), S95 (= S103), T96 (= T104), K111 (= K119), N114 (= N122), A117 (= A125), S118 (= S126), S119 (≠ G127)
4zojA Methylsulfanyl-containing inhibitor bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
38% identity, 95% coverage: 14:345/348 of query aligns to 6:338/341 of 4zojA
- active site: V82 (≠ C90)
- binding 4-methyl-2-{[2-methyl-6-(methylsulfanyl)phenyl]amino}benzoic acid: N114 (= N122), A155 (= A163), P156 (= P164), H159 (= H167), Y162 (≠ M170), R169 (= R177), G182 (= G190)
- binding magnesium ion: S95 (= S103), D227 (= D236), E228 (= E237), E228 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G91), G85 (= G93), G86 (= G94), N93 (= N101), S95 (= S103), T96 (= T104), K111 (= K119), R115 (= R123), A116 (≠ S124), A117 (= A125), S119 (≠ G127)
5c1rA Stereoisomer of prpp bound in the active site of mycobacterium tuberculosis anthranilate phosphoribosyl (anprt; trpd)
38% identity, 95% coverage: 14:345/348 of query aligns to 6:340/343 of 5c1rA
- active site: V82 (≠ C90)
- binding 5-O-[(R)-hydroxy(phosphonooxy)phosphoryl]-1-O-phosphono-alpha-D-ribofuranose: V82 (≠ C90), G83 (= G91), G86 (= G94), N93 (= N101), S95 (= S103), T96 (= T104), K111 (= K119), R115 (= R123), A117 (= A125), S118 (= S126), S119 (≠ G127)
- binding magnesium ion: D87 (= D95), V89 (≠ A97), S95 (= S103), E228 (= E237)
5c7sA Prpp complexed with two mn2+ in the active site of mycobacterium tuberculosis anthranilate phosphoribosyltransferase (anprt; trpd)
38% identity, 95% coverage: 14:345/348 of query aligns to 7:341/344 of 5c7sA
- active site: V83 (≠ C90)
- binding manganese (ii) ion: G84 (= G91), S96 (= S103), D228 (= D236), E229 (= E237), E229 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: V83 (≠ C90), G84 (= G91), G86 (= G93), G87 (= G94), N94 (= N101), S96 (= S103), T97 (= T104), K112 (= K119), N115 (= N122), S120 (≠ G127)
4giuA Bianthranilate-like analogue bound in inner site of anthranilate phosphoribosyltransferase (anprt; trpd). (see paper)
38% identity, 95% coverage: 14:345/348 of query aligns to 7:343/346 of 4giuA
- active site: V83 (≠ C90)
- binding 2-[(2-carboxy-5-methylphenyl)amino]-3-methylbenzoic acid: G114 (= G121), N115 (= N122), A156 (= A163), H160 (= H167), Y163 (≠ M170), R170 (= R177), G183 (= G190)
- binding magnesium ion: S96 (= S103), D228 (= D236), E229 (= E237), E229 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G84 (= G91), G86 (= G93), G87 (= G94), N94 (= N101), S96 (= S103), T97 (= T104), K112 (= K119), N115 (= N122), A117 (≠ S124), A118 (= A125), S119 (= S126), S120 (≠ G127), G123 (= G130)
4owmA Anthranilate phosphoribosyl transferase from mycobacterium tuberculosis in complex with 3-fluoroanthranilate, prpp and magnesium (see paper)
38% identity, 95% coverage: 14:345/348 of query aligns to 6:342/346 of 4owmA
- active site: V82 (≠ C90)
- binding 2-azanyl-3-fluoranyl-benzoic acid: P156 (= P164), H159 (= H167), Y162 (≠ M170), R163 (≠ K171), A166 (= A174), R170 (≠ K178)
- binding magnesium ion: S95 (= S103), D227 (= D236), E228 (= E237), E228 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G91), G86 (= G94), N93 (= N101), S95 (= S103), T96 (= T104), K111 (= K119), A117 (= A125), S118 (= S126), S119 (≠ G127), G122 (= G130)
4gkmA Bianthranilate-like analogue bound in the outer site of anthranilate phosphoribosyltransferase (anprt; trpd) (see paper)
38% identity, 95% coverage: 14:345/348 of query aligns to 6:342/346 of 4gkmA
- active site: V82 (≠ C90)
- binding 2-[(2-carboxyphenyl)amino]-5-methylbenzoic acid: N114 (= N122), A155 (= A163), P156 (= P164), Y162 (≠ M170), R163 (≠ K171), A166 (= A174), R169 (= R177), R170 (≠ K178)
- binding magnesium ion: S95 (= S103), D227 (= D236), E228 (= E237), E228 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G86 (= G94), N93 (= N101), S95 (= S103), T96 (= T104), K111 (= K119), A117 (= A125), S118 (= S126), S119 (≠ G127), G122 (= G130)
3r6cA Anthranilate phosphoribosyltransferase (trpd) from mycobacterium tuberculosis (complex with inhibitor acs179) (see paper)
38% identity, 95% coverage: 14:345/348 of query aligns to 6:342/346 of 3r6cA
- active site: V82 (≠ C90)
- binding 8-methoxyphenanthro[3,4-d][1,3]dioxole-5,6-dicarboxylic acid: M62 (≠ L70), N114 (= N122), A155 (= A163), P156 (= P164), H159 (= H167), Y162 (≠ M170), A166 (= A174), R169 (= R177), G182 (= G190), T185 (≠ V193), R239 (≠ I248), A241 (≠ R250), D246 (≠ S255), V301 (vs. gap), A310 (≠ G313), W312 (≠ Q315)
- binding magnesium ion: S95 (= S103), D227 (= D236), E228 (= E237), E228 (= E237)
- binding 1-O-pyrophosphono-5-O-phosphono-alpha-D-ribofuranose: G83 (= G91), G85 (= G93), G86 (= G94), N93 (= N101), S95 (= S103), T96 (= T104), K111 (= K119), N114 (= N122), R115 (= R123), A116 (≠ S124), A117 (= A125), S118 (= S126), S119 (≠ G127), G122 (= G130), G123 (≠ S131)
Query Sequence
>Synpcc7942_2123 FitnessBrowser__SynE:Synpcc7942_2123
MLVAPPAFAEAQVLLQRLLNHESLGAVQARALMEQWLSGTLPEALSGALLAALQSKGVSA
QELAAMAQVLQEQAVAVEASDRREPLVDTCGTGGDGAETFNISTAVAFVTAAAGVKVAKH
GNRSASGRVGSADVLEALGLNLTAPSDRIHAAVDEVGITFLFAPGWHPAMKAVAPLRKIL
GVRTVFNLLGPLVNPLRPTGQVIGVYNPGLLPTISGALAELGVRRAIVLHGREGLDEGGL
ADCTDLAIVREGQLSQQVVDPRDLGLTQAPTVALKGGSVEENADILKAVLQGKGTRAQQD
AVLLNAALALEVGEQVDRLDQGISLARSVLASGAAWQKLTQLAAFLQS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory