SitesBLAST
Comparing Synpcc7942_2143 FitnessBrowser__SynE:Synpcc7942_2143 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
73% identity, 92% coverage: 29:416/420 of query aligns to 1:383/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H114), K82 (= K115), Q109 (= Q142), S185 (= S218), G227 (= G260), G229 (= G262), S230 (= S263), N231 (= N264), E345 (= E378), S371 (= S404), G372 (= G405)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
59% identity, 92% coverage: 31:416/420 of query aligns to 3:383/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
59% identity, 92% coverage: 31:416/420 of query aligns to 3:383/386 of 1v8zA
- active site: K82 (= K115), E104 (= E137), S371 (= S404)
- binding pyridoxal-5'-phosphate: H81 (= H114), K82 (= K115), Q109 (= Q142), S185 (= S218), G227 (= G260), G228 (= G261), G229 (= G262), S230 (= S263), N231 (= N264), E345 (= E378), S371 (= S404), G372 (= G405)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
59% identity, 92% coverage: 31:416/420 of query aligns to 3:383/388 of 5dw0A
- active site: K82 (= K115), E104 (= E137), S371 (= S404)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H114), K82 (= K115), T105 (= T138), G106 (= G139), A107 (= A140), Q109 (= Q142), H110 (= H143), S185 (= S218), G227 (= G260), G229 (= G262), S230 (= S263), N231 (= N264), G298 (= G331), D300 (= D333), E345 (= E378), S371 (= S404)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
59% identity, 92% coverage: 31:416/420 of query aligns to 3:383/385 of 6am8B
- active site: K82 (= K115), E104 (= E137), S371 (= S404)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H114), K82 (= K115), E104 (= E137), T105 (= T138), G106 (= G139), A107 (= A140), Q109 (= Q142), H110 (= H143), L161 (= L194), S185 (= S218), V187 (≠ A220), G227 (= G260), G228 (= G261), G229 (= G262), S230 (= S263), N231 (= N264), G298 (= G331), Y301 (= Y334), E345 (= E378), S371 (= S404), G372 (= G405)
- binding tryptophan: P12 (= P40), L169 (≠ I202), S274 (≠ L307), H275 (= H308)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
58% identity, 92% coverage: 31:416/420 of query aligns to 3:383/384 of 7rnpA
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
59% identity, 92% coverage: 31:416/420 of query aligns to 3:382/383 of 5dw3A
- active site: K82 (= K115), E104 (= E137), S370 (= S404)
- binding tryptophan: K82 (= K115), E104 (= E137), T105 (= T138), G106 (= G139), A107 (= A140), Q109 (= Q142), H110 (= H143), S185 (= S218), G228 (= G261), Y300 (= Y334)
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
59% identity, 92% coverage: 31:416/420 of query aligns to 3:381/383 of 5t6mA
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
58% identity, 92% coverage: 31:416/420 of query aligns to 3:383/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H114), K82 (= K115), T105 (= T138), G106 (= G139), A107 (= A140), Q109 (= Q142), H110 (= H143), S185 (= S218), G227 (= G260), G229 (= G262), S230 (= S263), N231 (= N264), G298 (= G331), E345 (= E378), S371 (= S404)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
59% identity, 92% coverage: 31:416/420 of query aligns to 3:381/394 of 5ixjD
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
58% identity, 92% coverage: 31:416/420 of query aligns to 3:383/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H114), K82 (= K115), T105 (= T138), G106 (= G139), A107 (= A140), Q109 (= Q142), H110 (= H143), S185 (= S218), G227 (= G260), G229 (= G262), S230 (= S263), N231 (= N264), G298 (= G331), E345 (= E378), S371 (= S404)
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
59% identity, 92% coverage: 31:416/420 of query aligns to 3:381/383 of 5vm5D
- active site: K82 (= K115), E104 (= E137), S369 (= S404)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H114), K82 (= K115), T105 (= T138), G106 (= G139), A107 (= A140), Q109 (= Q142), H110 (= H143), S185 (= S218), G227 (= G260), G229 (= G262), S230 (= S263), N231 (= N264), G296 (= G331), E343 (= E378), S369 (= S404)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
58% identity, 93% coverage: 25:416/420 of query aligns to 9:398/404 of 6usaB
- active site: K97 (= K115), E119 (= E137), S386 (= S404)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H114), K97 (= K115), T120 (= T138), G121 (= G139), A122 (= A140), G123 (= G141), Q124 (= Q142), H125 (= H143), T200 (≠ S218), G242 (= G260), G244 (= G262), S245 (= S263), N246 (= N264), G313 (= G331), E360 (= E378), S386 (= S404)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ I202), W187 (= W205), Y196 (= Y214), F198 (≠ L216), G203 (= G221), P204 (= P222), F207 (≠ Y225), H290 (= H308), G291 (= G309)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
58% identity, 93% coverage: 25:416/420 of query aligns to 9:398/404 of 6dweB
- active site: K97 (= K115), E119 (= E137), S386 (= S404)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ I202), Y196 (= Y214), F198 (≠ L216), P204 (= P222), F207 (≠ Y225), H290 (= H308)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H114), K97 (= K115), T120 (= T138), G121 (= G139), A122 (= A140), G123 (= G141), Q124 (= Q142), H125 (= H143), T200 (≠ S218), G242 (= G260), G244 (= G262), S245 (= S263), N246 (= N264), G313 (= G331), E360 (= E378), S386 (= S404)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
58% identity, 93% coverage: 25:416/420 of query aligns to 10:399/406 of 5tciH
- active site: K98 (= K115), E120 (= E137), S387 (= S404)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (= P40), L31 (= L43), Y197 (= Y214), F199 (≠ L216), P205 (= P222), F208 (≠ Y225), H291 (= H308)
8eh1A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with 4-hydroxyquinoline
60% identity, 92% coverage: 29:414/420 of query aligns to 1:376/383 of 8eh1A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H114), K81 (= K115), T104 (= T138), G105 (= G139), A106 (= A140), Q108 (= Q142), H109 (= H143), S184 (= S218), G228 (= G262), S229 (= S263), N230 (= N264), G296 (= G331), E343 (= E378), S366 (= S404)
- binding quinolin-4-ol: G103 (≠ E137), L160 (= L194), I164 (≠ T198), G183 (= G217), S184 (= S218), Y299 (= Y334)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
58% identity, 93% coverage: 25:416/420 of query aligns to 5:394/399 of 5ocwB
- active site: K93 (= K115), E115 (= E137), S382 (= S404)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H114), K93 (= K115), T116 (= T138), G117 (= G139), A118 (= A140), Q120 (= Q142), H121 (= H143), T196 (≠ S218), G238 (= G260), G240 (= G262), S241 (= S263), N242 (= N264), G309 (= G331), E356 (= E378), S382 (= S404)
8eh0A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with quinoline n-oxide
60% identity, 92% coverage: 29:414/420 of query aligns to 1:376/385 of 8eh0A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H114), K81 (= K115), T104 (= T138), G105 (= G139), A106 (= A140), Q108 (= Q142), H109 (= H143), S184 (= S218), G228 (= G262), S229 (= S263), N230 (= N264), G296 (= G331), E343 (= E378), S366 (= S404), G367 (= G405)
- binding 1-oxo-1lambda~5~-quinoline: L160 (= L194), I164 (≠ T198), Y180 (= Y214), P182 (≠ L216), G183 (= G217), S184 (= S218), V186 (≠ A220), Y299 (= Y334)
8egyA Engineered holo tyrosine synthase (tmtyrs1) derived from t. Maritima trpb
60% identity, 92% coverage: 29:414/420 of query aligns to 1:376/385 of 8egyA
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
58% identity, 93% coverage: 25:416/420 of query aligns to 10:399/405 of 6u6cB
- active site: K98 (= K115), E120 (= E137), S387 (= S404)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H114), K98 (= K115), T121 (= T138), G122 (= G139), A123 (= A140), Q125 (= Q142), H126 (= H143), T201 (≠ S218), G243 (= G260), G245 (= G262), S246 (= S263), N247 (= N264), G314 (= G331), E361 (= E378), S387 (= S404)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (= Y38), F185 (≠ I202), W188 (= W205), Y197 (= Y214), F199 (≠ L216), G204 (= G221), P205 (= P222), H291 (= H308), G292 (= G309)
Query Sequence
>Synpcc7942_2143 FitnessBrowser__SynE:Synpcc7942_2143
VTQTPVNPSTTNAWANAIANLGERPDPLGRFGRFGGQYVPETLMPALAELEQAFARYSRD
PEFQAEFEGLLRDYVGRPNPLYFAERLTEYYRRPDGQGPNIYLKREDLNHTGAHKINNAL
GQALMAKRMGKKRIIAETGAGQHGVATATVCARFGLECVIYMGVHDMERQALNVFRMRLM
GAEVRGVAAGSGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVREFHSMIGREV
RQQAQTLWGGLPDILLACVGGGSNAMGLFNEFVNEPSVRLIGVEAAGRGVDTPEHAATLT
KGRVGVLHGAMSYLLQDDDGQVIEAHSISAGLDYPGVGPEHSYLMDAGRAEYYSVTDDEA
LEAFQRISRLEGIIPALETAHAFAHLEKLCPTLSGNPNLVINCSGRGDKDVQTVAQRLQF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory