SitesBLAST
Comparing Synpcc7942_2197 FitnessBrowser__SynE:Synpcc7942_2197 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
43% identity, 99% coverage: 2:365/367 of query aligns to 2:363/365 of 2j5tD
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
43% identity, 99% coverage: 2:365/367 of query aligns to 4:365/367 of P0A7B5
- S50 (= S49) binding
- D137 (= D136) binding
- N149 (= N148) binding
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
39% identity, 99% coverage: 2:365/367 of query aligns to 2:323/325 of 2j5vB
- binding pyroglutamic acid: T11 (= T11), G49 (= G50), A50 (= A51), I51 (≠ V52), A52 (≠ G53), D135 (= D136)
- binding gamma-glutamyl phosphate: K8 (= K8), S48 (= S49), D135 (= D136), G145 (= G146), D146 (= D147), N147 (= N148)
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
38% identity, 99% coverage: 2:365/367 of query aligns to 2:321/323 of 2j5vA
- binding magnesium ion: K8 (= K8), G10 (= G10), L166 (= L167)
- binding pyroglutamic acid: T11 (= T11), S48 (= S49), G49 (= G50), A50 (= A51), I51 (≠ V52)
- binding gamma-glutamyl phosphate: K8 (= K8), G10 (= G10), S48 (= S49), D135 (= D136), D146 (= D147), N147 (= N148)
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
35% identity, 68% coverage: 5:254/367 of query aligns to 15:256/258 of 7wx3B
- binding gamma-glutamyl phosphate: S59 (= S49), A61 (= A51), N149 (= N133), T150 (≠ E134), D152 (= D136), M158 (≠ E142), N165 (= N148)
- binding : E72 (vs. gap), M75 (vs. gap), L77 (= L61), S78 (≠ R62), M79 (≠ D63), R80 (= R64)
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
33% identity, 63% coverage: 5:235/367 of query aligns to 3:219/241 of 2akoA
- binding adenosine-5'-diphosphate: H10 (≠ S12), S161 (≠ T168), D162 (= D169), I163 (≠ V170), F166 (≠ L173), Y167 (= Y174), N170 (≠ D177), P171 (= P178), T194 (= T210), G196 (= G212), K200 (= K216)
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
35% identity, 68% coverage: 5:254/367 of query aligns to 15:234/236 of 7f5xA
8j0gB Gk monomer complexes with glutamate and atp
34% identity, 68% coverage: 5:255/367 of query aligns to 10:268/274 of 8j0gB
- binding adenosine-5'-triphosphate: K13 (= K8), G15 (= G10), T16 (= T11), A17 (≠ S12), V185 (= V170), G191 (≠ A176), P193 (= P178), F215 (≠ A201), R223 (≠ T210), G225 (= G212), M226 (= M213), K229 (= K216)
- binding gamma-l-glutamic acid: A55 (= A51), N147 (= N133), D150 (= D136), N163 (= N148), R223 (≠ T210)
- binding magnesium ion: R223 (≠ T210), G224 (= G211), G225 (= G212)
- binding : Y65 (≠ L61), L68 (vs. gap), V69 (vs. gap), F73 (vs. gap)
8j0eB Gk monomer complexes with catalytic intermediate
34% identity, 68% coverage: 5:255/367 of query aligns to 13:263/269 of 8j0eB
- binding magnesium ion: D163 (= D149), G219 (= G211)
- binding (2~{R})-5-[[[[(2~{R},3~{S},4~{S},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-2-azanyl-5-oxidanylidene-pentanoic acid: K16 (= K8), G18 (= G10), T19 (= T11), A20 (≠ S12), S56 (= S49), G57 (= G50), V59 (= V52), D153 (= D136), N162 (= N148), V184 (= V170), P192 (= P178), K217 (≠ Q204), R218 (≠ T210), G219 (= G211), G220 (= G212), M221 (= M213)
- binding : Y68 (≠ L61), L71 (vs. gap), V72 (vs. gap), V72 (vs. gap), S74 (vs. gap), F76 (vs. gap), F76 (vs. gap), Q80 (vs. gap)
8j0fA Gk tetramer with adjacent hooks at reaction state
33% identity, 68% coverage: 5:255/367 of query aligns to 14:262/270 of 8j0fA
- binding adenosine-5'-diphosphate: A21 (≠ S12), D183 (= D169), V184 (= V170), Y188 (= Y174), G190 (≠ A176), F214 (≠ A201), G219 (= G212), M220 (= M213)
- binding magnesium ion: R217 (≠ Q204), G218 (= G211), G219 (= G212)
- binding gamma-glutamyl phosphate: K17 (= K8), T20 (= T11), S57 (= S49), D154 (= D136), N162 (= N148), R217 (≠ Q204)
- binding : L72 (vs. gap), V73 (vs. gap), N74 (vs. gap), S75 (vs. gap), S76 (vs. gap), F77 (vs. gap), F77 (vs. gap), A78 (vs. gap), L80 (vs. gap)
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
30% identity, 30% coverage: 148:256/367 of query aligns to 120:225/225 of Q8U122
- T120 (≠ N148) binding
- D121 (= D149) binding ; binding
- G179 (≠ T210) binding
- S182 (≠ M213) binding
Sites not aligning to the query:
- 6 binding
- 44 binding
- 66 binding
- 114:120 binding
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
30% identity, 30% coverage: 148:256/367 of query aligns to 121:226/226 of 2bmuB
- binding phosphoaminophosphonic acid-adenylate ester: T141 (= T168), N142 (≠ D169), V146 (≠ L173), Y147 (= Y174), A149 (= A176), D150 (= D177), P151 (= P178), S182 (≠ G212), S183 (≠ M213), V184 (≠ A214)
- binding magnesium ion: D122 (= D149), D122 (= D149), S183 (≠ M213), V184 (≠ A214)
- binding uridine-5'-monophosphate: T121 (≠ N148), A179 (≠ G209)
Sites not aligning to the query:
- binding phosphoaminophosphonic acid-adenylate ester: 9, 10, 44, 45, 46
- binding magnesium ion: 7
- binding uridine-5'-monophosphate: 44, 45, 67, 70, 71, 114, 115, 116, 119, 120
2ji5A Structure of ump kinase from pyrococcus furiosus complexed with utp
30% identity, 30% coverage: 148:256/367 of query aligns to 122:219/219 of 2ji5A
Sites not aligning to the query:
7lnuB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
24% identity, 68% coverage: 2:250/367 of query aligns to 2:252/261 of 7lnuB
- binding adenosine-5'-diphosphate: K8 (= K8), S12 (= S12), S172 (≠ T168), D173 (= D169), I174 (≠ V170), Y178 (= Y174), A180 (= A176), K183 (≠ R179), K218 (= K216)
- binding Isopentenyl phosphate: A48 (≠ S49), G52 (= G53), H53 (vs. gap), I149 (vs. gap), S151 (≠ D147), G152 (≠ N148)
7lntB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
24% identity, 68% coverage: 2:250/367 of query aligns to 1:251/260 of 7lntB
- binding adenosine-5'-diphosphate: G9 (= G10), G10 (≠ T11), S11 (= S12), D172 (= D169), I173 (≠ V170), Y177 (= Y174), D180 (= D177)
- binding (phenylmethyl) dihydrogen phosphate: A47 (≠ S49), G51 (= G53), H52 (vs. gap), I148 (vs. gap), S150 (≠ D147)
7n9dA I74a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
24% identity, 37% coverage: 114:250/367 of query aligns to 115:248/253 of 7n9dA
- binding (2E)-3-phenylbut-2-en-1-yl dihydrogen phosphate: G135 (≠ N135), D136 (= D136), V137 (≠ T137), I147 (vs. gap), S149 (≠ D147), G150 (≠ N148), T208 (= T210)
- binding adenosine-5'-diphosphate: S170 (≠ T168), D171 (= D169), I172 (≠ V170), Y176 (= Y174), A178 (= A176), D179 (= D177), D201 (≠ S198), G210 (= G212), V211 (≠ M213), K214 (= K216)
Sites not aligning to the query:
7lnxB I146a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
23% identity, 68% coverage: 2:250/367 of query aligns to 4:238/247 of 7lnxB
- binding adenosine-5'-diphosphate: K10 (= K8), S14 (= S12), S174 (≠ T168), D175 (= D169), I176 (≠ V170), Y180 (= Y174), A182 (= A176), D183 (= D177), P184 (= P178), K185 (≠ R179), K204 (= K216)
- binding (2E)-3-methylhept-2-en-1-yl dihydrogen phosphate: A50 (≠ S49), G54 (= G53), H55 (vs. gap), A58 (≠ C56), D140 (= D136), V141 (≠ T137), A151 (vs. gap), G154 (≠ N148)
7lnuA Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
22% identity, 68% coverage: 2:250/367 of query aligns to 1:230/239 of 7lnuA
- binding adenosine-5'-diphosphate: G9 (= G10), G10 (≠ T11), S11 (= S12), K16 (≠ P17), D172 (= D169), I173 (≠ V170), L176 (= L173), D180 (= D177), K182 (≠ R179)
- binding adenosine-5'-triphosphate: K7 (= K8), G9 (= G10), G10 (≠ T11), S11 (= S12), K16 (≠ P17), D172 (= D169), L176 (= L173), A179 (= A176), D180 (= D177), K182 (≠ R179)
- binding Isopentenyl phosphate: G46 (vs. gap), A47 (≠ S49), G51 (= G53), H52 (vs. gap), G136 (≠ N135), I148 (vs. gap), S150 (≠ D147), G151 (≠ N148)
- binding 3-methylbut-3-enyl trihydrogen diphosphate: A47 (≠ S49), G51 (= G53), H52 (vs. gap), G136 (≠ N135), I148 (vs. gap), G151 (≠ N148)
7lntA Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
22% identity, 68% coverage: 2:250/367 of query aligns to 1:230/238 of 7lntA
- binding adenosine-5'-diphosphate: G9 (= G10), S11 (= S12), K16 (≠ P17), S171 (≠ T168), D172 (= D169), I173 (≠ V170), Y177 (= Y174), A179 (= A176), D180 (= D177), P181 (= P178), K182 (≠ R179), K196 (= K216)
- binding (phenylmethyl) dihydrogen phosphate: G46 (vs. gap), A47 (≠ S49), G51 (= G53), H52 (vs. gap), I148 (vs. gap), S150 (≠ D147), G151 (≠ N148)
7lnwA I146a mutant of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus (see paper)
23% identity, 67% coverage: 5:250/367 of query aligns to 3:247/256 of 7lnwA
- binding adenosine-5'-diphosphate: K6 (= K8), S10 (= S12), K15 (≠ P17), D171 (= D169), I172 (≠ V170), Y176 (= Y174), D179 (= D177), P180 (= P178), K181 (≠ R179), V210 (≠ M213), K213 (= K216)
- binding [(~{Z})-5-[(azanylidene-$l^{4}-azanylidene)amino]-3-methyl-pent-2-enyl] dihydrogen phosphate: G45 (vs. gap), A46 (≠ S49), G50 (= G53), H51 (vs. gap), G135 (≠ N135), D136 (= D136), V148 (vs. gap), S149 (≠ D147)
Query Sequence
>Synpcc7942_2197 FitnessBrowser__SynE:Synpcc7942_2197
MSETLVVKIGTSSLTNPHHPGLALSTIAGLVEVICQLRRQGYNVVLVSSGAVGVGCTRLG
LRDRPSRIAQRQAIAAVGQGRLMRTYDDLFTTLGQPIAQVLLTRGDLAQRQRYINAYQTF
QELFELGVVPIVNENDTVAVEELKFGDNDTLSALVASLVEAQWLFLLTDVDRLYTADPRQ
DPNAKPITIVHDLSELESIQAGGQGSRWGTGGMATKLTAAKIATQASVRTVITQGRSPEN
LLKILAGEAIGTWFEPQPETVNARKRWIAHGLVPTGKLLLDAGAVQAIQAGGKSLLAAGI
QAIEGDFEAQDAVQLCDLNGTEIARGLVNYDSHELQQIRGCQSDQIVQILGYEGAETIVH
RDNLVLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory