SitesBLAST
Comparing Synpcc7942_2201 FitnessBrowser__SynE:Synpcc7942_2201 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6q70A Crystal structure of the alanine racemase bsu17640 from bacillus subtilis in the presence of hepes (see paper)
37% identity, 91% coverage: 25:393/406 of query aligns to 6:379/386 of 6q70A
- active site: K39 (= K58), R139 (= R157), H169 (= H186), R225 (= R242), Y272 (= Y286), T319 (= T333), D321 (= D335)
- binding pyridoxal-5'-phosphate: V37 (= V56), K39 (= K58), Y43 (= Y62), L85 (= L104), R139 (= R157), H169 (= H186), T210 (≠ S227), R225 (= R242), G227 (= G244), I228 (≠ L245), Y364 (≠ W378)
5irpA Crystal structure of the alanine racemase bsu17640 from bacillus subtilis (see paper)
37% identity, 91% coverage: 25:393/406 of query aligns to 6:379/386 of 5irpA
- active site: K39 (= K58), R139 (= R157), H169 (= H186), R225 (= R242), Y272 (= Y286), T319 (= T333), D321 (= D335)
- binding magnesium ion: L155 (= L175), K156 (≠ P176), S158 (vs. gap), L161 (= L178)
- binding 2-amino-2-hydroxymethyl-propane-1,3-diol: D174 (= D191), P235 (= P252), Y364 (≠ W378)
- binding (5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: Y43 (= Y62), L85 (= L104), R139 (= R157), H169 (= H186), N209 (= N226), T210 (≠ S227), R225 (= R242), G227 (= G244), I228 (≠ L245), Y364 (≠ W378)
2vd9A The crystal structure of alanine racemase from bacillus anthracis (ba0252) with bound l-ala-p (see paper)
38% identity, 91% coverage: 24:393/406 of query aligns to 4:371/386 of 2vd9A
- active site: K38 (= K58), R135 (= R157), H165 (= H186), R221 (= R242), Y267 (= Y286), T313 (= T333), D315 (= D335)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: K38 (= K58), Y42 (= Y62), R135 (= R157), H165 (= H186), N205 (= N226), S206 (= S227), G223 (= G244), I224 (≠ L245), Y267 (= Y286), T313 (= T333), M314 (= M334), Y356 (≠ W378)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: K38 (= K58), Y42 (= Y62), R135 (= R157), H165 (= H186), S206 (= S227), R221 (= R242), G223 (= G244), I224 (≠ L245), Y267 (= Y286), T313 (= T333), M314 (= M334), Y356 (≠ W378)
- binding magnesium ion: T329 (≠ D351), K330 (≠ V352)
2vd8A The crystal structure of alanine racemase from bacillus anthracis (ba0252) (see paper)
38% identity, 91% coverage: 24:393/406 of query aligns to 5:372/387 of 2vd8A
- active site: K39 (= K58), R136 (= R157), H166 (= H186), R222 (= R242), Y268 (= Y286), T314 (= T333), D316 (= D335)
- binding pyridoxal-5'-phosphate: K39 (= K58), Y43 (= Y62), R136 (= R157), H166 (= H186), S207 (= S227), R222 (= R242), G224 (= G244), I225 (≠ L245), Y357 (≠ W378)
6sczA Mycobacterium tuberculosis alanine racemase inhibited by dcs (see paper)
41% identity, 89% coverage: 31:390/406 of query aligns to 8:368/373 of 6sczA
- active site: K34 (= K58), R132 (= R157), H164 (= H186), R220 (= R242), Y263 (= Y286), C310 (≠ T333), D312 (= D335)
- binding (~{E})-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylidene-[(4~{R})-3-oxidanylidene-1,2-oxazolidin-4-yl]azanium: K34 (= K58), Y38 (= Y62), W80 (≠ L104), H164 (= H186), S205 (= S227), R220 (= R242), G222 (= G244), I223 (≠ L245), Y356 (≠ W378)
- binding [2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methyl-(3-oxidanyl-1,2-oxazol-4-yl)azanium: Y38 (= Y62), W80 (≠ L104), H164 (= H186), N204 (= N226), S205 (= S227), R220 (= R242), G222 (= G244), I223 (≠ L245), Y263 (= Y286), Y282 (= Y305), M311 (= M334), Y356 (≠ W378)
- binding polyethylene glycol: D172 (= D194), A210 (≠ L232), P212 (≠ S234)
P9WQA9 Alanine racemase; EC 5.1.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
41% identity, 89% coverage: 31:390/406 of query aligns to 16:376/384 of P9WQA9
- K42 (= K58) modified: N6-(pyridoxal phosphate)lysine
4y2wA Crystal structure of a thermostable alanine racemase from thermoanaerobacter tengcongensis mb4 (see paper)
35% identity, 89% coverage: 29:390/406 of query aligns to 11:372/388 of 4y2wA
- active site: K40 (= K58), R138 (= R157), H168 (= H186), R224 (= R242), Y268 (= Y286), C315 (≠ T333), D317 (= D335)
- binding alanine: Y268 (= Y286), Y287 (= Y305), C315 (≠ T333), M316 (= M334)
- binding phosphate ion: N208 (= N226), A209 (≠ S227), I227 (≠ L245)
5yycA Crystal structure of alanine racemase from bacillus pseudofirmus (of4) (see paper)
37% identity, 91% coverage: 23:391/406 of query aligns to 5:365/368 of 5yycA
- active site: K41 (= K58), R139 (= R157), H169 (= H186), R225 (= R242), Y269 (= Y286), C316 (≠ T333), D318 (= D335)
- binding pyridoxal-5'-phosphate: K41 (= K58), Y45 (= Y62), R139 (= R157), H169 (= H186), N209 (= N226), S210 (= S227), R225 (= R242), G227 (= G244), I228 (≠ L245), Y352 (≠ W378)
1xfcA The 1.9 a crystal structure of alanine racemase from mycobacterium tuberculosis contains a conserved entryway into the active site (see paper)
40% identity, 89% coverage: 31:390/406 of query aligns to 6:361/366 of 1xfcA
- active site: K32 (= K58), R130 (= R157), H162 (= H186), R213 (= R242), C303 (≠ T333), D305 (= D335)
- binding pyridoxal-5'-phosphate: K32 (= K58), Y36 (= Y62), W78 (≠ L104), H162 (= H186), S198 (= S227), R213 (= R242), G215 (= G244), I216 (≠ L245), Y349 (≠ W378)
1ftxA Crystal structure of alanine racemase in complex with d-alanine phosphonate
39% identity, 90% coverage: 24:390/406 of query aligns to 4:365/380 of 1ftxA
- active site: K38 (= K58), R135 (= R157), H165 (= H186), R218 (= R242), Y264 (= Y286), C310 (≠ T333), D312 (= D335)
- binding (1s)-1-[((1e)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylene)amino]ethylphosphonic acid: K38 (= K58), Y42 (= Y62), R135 (= R157), H165 (= H186), N202 (= N226), S203 (= S227), R218 (= R242), G220 (= G244), I221 (≠ L245), Y264 (= Y286), C310 (≠ T333), M311 (= M334), Y353 (≠ W378)
1l6gA Alanine racemase bound with n-(5'-phosphopyridoxyl)-d-alanine (see paper)
39% identity, 90% coverage: 24:390/406 of query aligns to 4:365/382 of 1l6gA
- active site: K38 (= K58), R135 (= R157), H165 (= H186), R218 (= R242), Y264 (= Y286), C310 (≠ T333), D312 (= D335)
- binding n-(5'-phosphopyridoxyl)-d-alanine: K38 (= K58), Y42 (= Y62), R135 (= R157), H165 (= H186), S203 (= S227), R218 (= R242), G220 (= G244), I221 (≠ L245), Y264 (= Y286), C310 (≠ T333), M311 (= M334), Y353 (≠ W378)
1l6fA Alanine racemase bound with n-(5'-phosphopyridoxyl)-l-alanine (see paper)
39% identity, 90% coverage: 24:390/406 of query aligns to 4:365/382 of 1l6fA
- active site: K38 (= K58), R135 (= R157), H165 (= H186), R218 (= R242), Y264 (= Y286), C310 (≠ T333), D312 (= D335)
- binding alanyl-pyridoxal-5'-phosphate: K38 (= K58), Y42 (= Y62), R135 (= R157), H165 (= H186), N202 (= N226), S203 (= S227), R218 (= R242), G220 (= G244), I221 (≠ L245), Y264 (= Y286), C310 (≠ T333), M311 (= M334), Y353 (≠ W378)
1epvA Alanine racemase with bound inhibitor derived from d- cycloserine (see paper)
39% identity, 90% coverage: 24:390/406 of query aligns to 4:365/382 of 1epvA
- active site: K38 (= K58), R135 (= R157), H165 (= H186), R218 (= R242), Y264 (= Y286), C310 (≠ T333), D312 (= D335)
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K38 (= K58), Y42 (= Y62), L84 (= L104), R135 (= R157), H165 (= H186), S203 (= S227), R218 (= R242), G220 (= G244), I221 (≠ L245), Y264 (= Y286), C310 (≠ T333), M311 (= M334), Y353 (≠ W378)
1bd0A Alanine racemase complexed with alanine phosphonate (see paper)
39% identity, 90% coverage: 24:390/406 of query aligns to 4:365/381 of 1bd0A
- active site: K38 (= K58), R135 (= R157), H165 (= H186), R218 (= R242), Y264 (= Y286), C310 (≠ T333), D312 (= D335)
- binding {1-[(3-hydroxy-methyl-5-phosphonooxy-methyl-pyridin-4-ylmethyl)-amino]-ethyl}-phosphonic acid: K38 (= K58), Y42 (= Y62), R135 (= R157), H165 (= H186), N202 (= N226), S203 (= S227), R218 (= R242), G220 (= G244), I221 (≠ L245), Y264 (= Y286), C310 (≠ T333), M311 (= M334), Y353 (≠ W378)
1sftA Alanine racemase (see paper)
39% identity, 90% coverage: 24:390/406 of query aligns to 4:365/382 of 1sftA
- active site: K38 (= K58), R135 (= R157), H165 (= H186), R218 (= R242), Y264 (= Y286), C310 (≠ T333), D312 (= D335)
- binding pyridoxal-5'-phosphate: K38 (= K58), Y42 (= Y62), L84 (= L104), R135 (= R157), H165 (= H186), S203 (= S227), R218 (= R242), G220 (= G244), I221 (≠ L245), Y353 (≠ W378)
P10724 Alanine racemase; EC 5.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 8 papers)
39% identity, 90% coverage: 24:390/406 of query aligns to 5:366/388 of P10724
- K39 (= K58) modified: N6-(pyridoxal phosphate)lysine; mutation to A: Loss of activity.
- K129 (= K150) modified: N6-carboxylysine
- R136 (= R157) binding
- H166 (= H186) mutation to A: 6.5-fold decrease in activity.
- R219 (= R242) mutation to A: 100-fold decrease in activity.; mutation to E: 1000-fold decrease in activity.; mutation to K: 4-fold decrease in activity.
- Y265 (= Y286) mutation to A: 5000-fold decrease in activity.; mutation to F: Loss of activity.; mutation to S: 2000-fold decrease in activity.
- M312 (= M334) binding
- Y354 (≠ W378) mutation to A: 54-fold increase in serine racemase activity.; mutation to N: 81-fold increase in serine racemase activity.; mutation to Q: 51-fold increase in serine racemase activity.
1xqlA Effect of a y265f mutant on the transamination based cycloserine inactivation of alanine racemase (see paper)
39% identity, 90% coverage: 24:390/406 of query aligns to 4:365/382 of 1xqlA
- active site: K38 (= K58), R135 (= R157), H165 (= H186), R218 (= R242), F264 (≠ Y286), C310 (≠ T333), D312 (= D335)
- binding (r)-4-amino-isoxazolidin-3-one: F264 (≠ Y286), M311 (= M334)
- binding pyridoxal-5'-phosphate: K38 (= K58), Y42 (= Y62), L84 (= L104), H165 (= H186), S203 (= S227), R218 (= R242), G220 (= G244), I221 (≠ L245), Y353 (≠ W378)
- binding (5-hydroxy-4-{[(3-hydroxyisoxazol-4-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: K38 (= K58), Y42 (= Y62), L84 (= L104), R135 (= R157), H165 (= H186), N202 (= N226), S203 (= S227), R218 (= R242), G220 (= G244), I221 (≠ L245), F264 (≠ Y286), Y283 (= Y305), M311 (= M334), Y353 (≠ W378)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: Y42 (= Y62), R135 (= R157), H165 (= H186), N202 (= N226), S203 (= S227), R218 (= R242), G220 (= G244), I221 (≠ L245), Y353 (≠ W378)
1xqkA Effect of a y265f mutant on the transamination based cycloserine inactivation of alanine racemase (see paper)
39% identity, 90% coverage: 24:390/406 of query aligns to 4:365/382 of 1xqkA
- active site: K38 (= K58), R135 (= R157), H165 (= H186), R218 (= R242), F264 (≠ Y286), C310 (≠ T333), D312 (= D335)
- binding (5-hydroxy-4-{[(3-hydroxyisoxazol-4-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: K38 (= K58), Y42 (= Y62), L84 (= L104), R135 (= R157), H165 (= H186), N202 (= N226), S203 (= S227), R218 (= R242), G220 (= G244), I221 (≠ L245), F264 (≠ Y286), M311 (= M334), Y353 (≠ W378)
1vfsA Crystal structure of d-cycloserine-bound form of alanine racemase from d-cycloserine-producing streptomyces lavendulae (see paper)
38% identity, 90% coverage: 26:390/406 of query aligns to 5:371/383 of 1vfsA
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: K36 (= K58), Y40 (= Y62), W82 (≠ L104), R134 (= R157), H166 (= H186), S207 (= S227), R222 (= R242), G224 (= G244), Y268 (= Y286), Y287 (= Y305), M316 (= M334), Y359 (≠ W378)
1vfhA Crystal structure of alanine racemase from d-cycloserine producing streptomyces lavendulae (see paper)
38% identity, 90% coverage: 26:390/406 of query aligns to 5:371/382 of 1vfhA
- active site: K36 (= K58), R134 (= R157), H166 (= H186), R222 (= R242), Y268 (= Y286), A315 (≠ T333), D317 (= D335)
- binding pyridoxal-5'-phosphate: K36 (= K58), Y40 (= Y62), W82 (≠ L104), H166 (= H186), S207 (= S227), R222 (= R242), G224 (= G244), L225 (= L245), Y359 (≠ W378)
Query Sequence
>Synpcc7942_2201 FitnessBrowser__SynE:Synpcc7942_2201
VTVKPIDPQPTPRWPARRLEQLSYQRAWVEVDQGAIAANTRQIRQFLAPSCELMAVVKAD
AYGHGAVAIASTVLGAGATALGVATIPEGVRLREAGITAPILLLGSIHSPDEVQAIAHWQ
IQPSLSTPKQALICAEVLDRLGQSLPVHLKLDTGMSRLGAPWQTAVEFLQLVHGLPSLQL
ASLYSHFATADSPDRAPLQQQHAAFEQAIAQIQAEGLPVPKLHIANSAATLLDSSLHYDQ
VRVGLALYGLYPAPHLGDRLSLYPALSVKARVTHVTTLPAGQGVSYGHRYVTQRETPIAV
VGIGYADGVPRALSNQMEVLYRGQRLPQIGAITMDQMMIDISAMPQLAPGDVVTLLGRSG
SEQITADDWADRANTISWEILCGFKDRLPRFAVAADWSSNQVTVRS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory