Comparing Synpcc7942_2249 FitnessBrowser__SynE:Synpcc7942_2249 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q57763 S-adenosylmethionine decarboxylase proenzyme; AdoMetDC; SAMDC; EC 4.1.1.50 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
47% identity, 77% coverage: 17:125/141 of query aligns to 5:113/124 of Q57763
Q9WZC3 S-adenosylmethionine decarboxylase proenzyme; AdoMetDC; SAMDC; EC 4.1.1.50 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
42% identity, 72% coverage: 16:117/141 of query aligns to 3:104/130 of Q9WZC3
O34426 S-adenosylmethionine decarboxylase proenzyme; AdoMetDC; SAMDC; EC 4.1.1.50 from Bacillus subtilis (strain 168) (see paper)
37% identity, 83% coverage: 17:133/141 of query aligns to 4:120/126 of O34426
Q9UWY8 S-adenosylmethionine decarboxylase proenzyme; AdoMetDC; SAMDC; EC 4.1.1.50 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
34% identity, 79% coverage: 14:125/141 of query aligns to 10:120/124 of Q9UWY8
2iiiA Crystal structure of the adenosylmethionine decarboxylase (aq_254) from aquifex aeolicus vf5
38% identity, 72% coverage: 17:117/141 of query aligns to 4:103/120 of 2iiiA
Q9UWU1 Arginine decarboxylase proenzyme; ADC; ArgDC; Pyruvoyl-dependent arginine decarboxylase; EC 4.1.1.19 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
33% identity, 80% coverage: 8:120/141 of query aligns to 8:126/134 of Q9UWU1
3iwdB T. Maritima adometdc complex with 5'-deoxy-5'-dimethyl thioadenosine (see paper)
37% identity, 43% coverage: 16:75/141 of query aligns to 2:61/61 of 3iwdB
3iwcB T. Maritima adometdc complex with s-adenosylmethionine methyl ester (see paper)
37% identity, 43% coverage: 16:75/141 of query aligns to 2:61/61 of 3iwcB
>Synpcc7942_2249 FitnessBrowser__SynE:Synpcc7942_2249
MTSFYLEQETFEPPGAVGTHCILELYGCPAELLNDADQIQANLRAAATEAGATLLQETCH
RFEPQGVTALALLAESHISIHTWPESGYAAVDVFTCGSHTQPETACHFLIEAFRSRQYTL
HTLRRQPPASIREVSRDPVAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory