Comparing Synpcc7942_2258 FitnessBrowser__SynE:Synpcc7942_2258 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3if2A Crystal structure of putative amino-acid aminotransferase (yp_265399.1) from psychrobacter arcticum 273-4 at 2.50 a resolution
33% identity, 97% coverage: 5:420/427 of query aligns to 3:434/437 of 3if2A
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
25% identity, 92% coverage: 25:418/427 of query aligns to 21:400/404 of 3wx9A
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
25% identity, 92% coverage: 25:418/427 of query aligns to 21:400/404 of 3av7A
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
25% identity, 92% coverage: 25:418/427 of query aligns to 21:400/404 of 3aowC
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
25% identity, 92% coverage: 25:418/427 of query aligns to 21:400/404 of 3aovA
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
24% identity, 92% coverage: 25:418/427 of query aligns to 18:398/403 of 1wstA
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
20% identity, 97% coverage: 5:419/427 of query aligns to 3:398/402 of P14909
Sites not aligning to the query:
3eleA Crystal structure of amino transferase (rer070207001803) from eubacterium rectale at 2.10 a resolution
24% identity, 63% coverage: 10:279/427 of query aligns to 5:273/398 of 3eleA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
23% identity, 80% coverage: 76:418/427 of query aligns to 58:384/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
23% identity, 80% coverage: 76:418/427 of query aligns to 58:384/388 of 1gd9A
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
24% identity, 96% coverage: 3:413/427 of query aligns to 1:379/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
24% identity, 96% coverage: 3:413/427 of query aligns to 1:379/382 of 1bjwA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
24% identity, 96% coverage: 3:413/427 of query aligns to 1:379/385 of Q56232
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
24% identity, 96% coverage: 3:413/427 of query aligns to 1:379/382 of 1b5oA
1j32A Aspartate aminotransferase from phormidium lapideum
26% identity, 79% coverage: 75:412/427 of query aligns to 62:380/388 of 1j32A
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
24% identity, 96% coverage: 3:413/427 of query aligns to 1:379/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
24% identity, 96% coverage: 3:413/427 of query aligns to 1:379/382 of 1gc3A
4fl0B Crystal structure of ald1 from arabidopsis thaliana (see paper)
28% identity, 54% coverage: 177:406/427 of query aligns to 171:397/409 of 4fl0B
Sites not aligning to the query:
Q9ZQI7 Aminotransferase ALD1, chloroplastic; AGD2-like defense response protein 1; EC 2.6.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 54% coverage: 177:406/427 of query aligns to 204:430/456 of Q9ZQI7
Sites not aligning to the query:
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
24% identity, 89% coverage: 35:412/427 of query aligns to 31:384/393 of 6l1lB
>Synpcc7942_2258 FitnessBrowser__SynE:Synpcc7942_2258
MSLESLSRYGRQMSQLTGVRAIMKDIIETLRSGQGQTFINLSAGNPVVLPEVEQLWRDCT
ADLLGSAEYGQVVGRYGTSQGYEPLIAAIIQEFNQRYGWSISDRNILITPGSQSLYFLAA
NAFGGWAEDGSLRKILLPLSPDYTGYGGVCLEPQAVVAARPQIERIGDHRFKYRPDFEQL
QIGADTGMLLFSRPCNPTGNVISDAELERLATLAAAQNVPVFVDSAYAPPFPGLNFTEMT
PFFGDNIVHCLSLSKAGLPGERLGIAIGPEPVIQVLEAFQTNLCIHSSRYGQAIAARAIA
SGQLTAIAETVIRPYYAAKFARVERQLDALLPDSLPWRLHQGEGGIFAWLWLEEAPLDDW
QIYQQLKQAGVIVVPGSSFFPGLREDWVHTRQCLRISLAAEDHELETGMERLATTVQQIY
RQAPIPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory