Comparing Synpcc7942_2265 FitnessBrowser__SynE:Synpcc7942_2265 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
43% identity, 98% coverage: 8:428/431 of query aligns to 2:424/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
43% identity, 98% coverage: 8:428/431 of query aligns to 2:424/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
33% identity, 86% coverage: 35:406/431 of query aligns to 28:405/412 of 4jbeB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
24% identity, 65% coverage: 16:297/431 of query aligns to 22:287/455 of 5j7iC
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
24% identity, 65% coverage: 16:297/431 of query aligns to 23:288/456 of 5j7iB
Sites not aligning to the query:
>Synpcc7942_2265 FitnessBrowser__SynE:Synpcc7942_2265
VATLSVDLEVQAQATRAAARQLAQWSGADRQRLLSAIATTLEQEAPRILAANQADCEAAT
TEGIAPALYARLKLDADKLAAAIAGVRDLAQLPDPLGQIQIDRELDEGLILQRLTCPVGV
LGVIFEARPDAVIQIASLAIKSGNGAILKGGREAICSCQAIVAAIAQALAEQQAPVEAIR
LLTSREETLALLKLDRYVDLIIPRGSNSFVRFVQDNTHIPVLGHADGICHLYVDQAAAIE
KTVTITVDAKTQYPAACNAIETLLIHEAIAPQFLPVVAAALHEKGVSLRGDAAAQTIVPM
EAATEEDWRTEYSDLVLAVRLVPSLDAAIAHINEYGSGHTDAIATEDAAAAAQFFSQVDS
AGVYHNCSTRFADGFRYGFGAEVGISTQKLPPRGPVGLEGLVTYKYVLSGDGQIAATYSG
AQAKPFLHRDR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory