Comparing Synpcc7942_2285 FitnessBrowser__SynE:Synpcc7942_2285 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mcaA Crystal structure of glycerol dehydrogenase from serratia to 1.9a
32% identity, 96% coverage: 2:345/359 of query aligns to 12:354/367 of 4mcaA
Q9WYQ4 Glycerol dehydrogenase; GDH; GLDH; EC 1.1.1.6 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
33% identity, 95% coverage: 2:343/359 of query aligns to 12:350/364 of Q9WYQ4
1kq3A Crystal structure of a glycerol dehydrogenase (tm0423) from thermotoga maritima at 1.5 a resolution (see paper)
33% identity, 95% coverage: 2:343/359 of query aligns to 13:351/364 of 1kq3A
8gobA Crystal structure of glycerol dehydrogenase in the presence of NAD+ (see paper)
35% identity, 96% coverage: 2:344/359 of query aligns to 12:353/367 of 8gobA
8goaA Crystal structure of glycerol dehydrogenase in the absence of NAD+ (see paper)
35% identity, 96% coverage: 2:344/359 of query aligns to 12:353/367 of 8goaA
5zxlA Structure of glda from e.Coli (see paper)
35% identity, 96% coverage: 2:344/359 of query aligns to 12:353/367 of 5zxlA
P0A9S5 Glycerol dehydrogenase; GDH; GLDH; (R)-aminopropanol dehydrogenase; 1,2-propanediol dehydrogenase; D-1-amino-2-propanol oxidoreductase; EC 1.1.1.6; EC 1.1.1.75 from Escherichia coli (strain K12) (see paper)
35% identity, 96% coverage: 2:344/359 of query aligns to 12:353/367 of P0A9S5
5xn8A Structure of glycerol dehydrogenase crystallised as a contaminant
33% identity, 96% coverage: 2:345/359 of query aligns to 12:354/365 of 5xn8A
3uhjA Crystal structure of a probable glycerol dehydrogenase from sinorhizobium meliloti 1021
33% identity, 86% coverage: 27:334/359 of query aligns to 29:338/357 of 3uhjA
P32816 Glycerol dehydrogenase; GDH; GLDH; GlyDH; EC 1.1.1.6 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
35% identity, 81% coverage: 57:345/359 of query aligns to 69:356/370 of P32816
Sites not aligning to the query:
1jq5A Bacillus stearothermophilus glycerol dehydrogenase complex with NAD+ (see paper)
35% identity, 81% coverage: 57:345/359 of query aligns to 68:355/366 of 1jq5A
Sites not aligning to the query:
O13702 Glycerol dehydrogenase 1; GDH; GLDH; EC 1.1.1.6 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)
34% identity, 79% coverage: 60:343/359 of query aligns to 129:414/450 of O13702
1ta9B Crystal structure of glycerol dehydrogenase from schizosaccharomyces pombe
34% identity, 79% coverage: 60:343/359 of query aligns to 73:358/394 of 1ta9B
1jqaA Bacillus stearothermophilus glycerol dehydrogenase complex with glycerol (see paper)
34% identity, 81% coverage: 57:345/359 of query aligns to 67:350/361 of 1jqaA
4rgqB Crystal structure of the methanocaldococcus jannaschii g1pdh with NADPH and dhap (see paper)
34% identity, 25% coverage: 76:164/359 of query aligns to 68:149/333 of 4rgqB
Sites not aligning to the query:
4rgvA Crystal structure of the methanocaldococcus jannaschii g1pdh (see paper)
35% identity, 25% coverage: 76:164/359 of query aligns to 65:144/328 of 4rgvA
Sites not aligning to the query:
Q9YER2 Glycerol-1-phosphate dehydrogenase [NAD(P)+]; G1P dehydrogenase; G1PDH; Gro1PDH; Enantiomeric glycerophosphate synthase; sn-glycerol-1-phosphate dehydrogenase; EC 1.1.1.261 from Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) (see paper)
25% identity, 77% coverage: 1:277/359 of query aligns to 14:287/352 of Q9YER2
3ce9A Crystal structure of glycerol dehydrogenase (np_348253.1) from clostridium acetobutylicum at 2.37 a resolution
27% identity, 25% coverage: 74:164/359 of query aligns to 83:170/349 of 3ce9A
Sites not aligning to the query:
5fb3F Structure of glycerophosphate dehydrogenase in complex with NADPH (see paper)
25% identity, 56% coverage: 76:277/359 of query aligns to 72:273/337 of 5fb3F
Sites not aligning to the query:
6jkpA Crystal structure of sulfoacetaldehyde reductase from bifidobacterium kashiwanohense in complex with NAD+ (see paper)
27% identity, 52% coverage: 72:258/359 of query aligns to 84:278/376 of 6jkpA
Sites not aligning to the query:
>Synpcc7942_2285 FitnessBrowser__SynE:Synpcc7942_2285
VLRGWGALSEAGSAIARVGQRPLVVGGDRARALVQDSLTAIASEQSLTLGWGSSLPDCSE
AVLARLQQAATEHQADCILGVGGGKALDTAKLLGHQLSLPVITVPTSAATCAAWTALANV
YTDAGAWLYDVGLDRCPELLILDFELIAQAPPRTLAAGIGDAIAKWYEASVSSGHRQETL
VVAAVQQARVLRDLLFQKSAAAIAEPGGEQWYEVVEATVLLAGVIGGLGGAQCRTVAAHA
VHNGLTHLPACHDWLHGEKVAFGILVQLRLEELQGTNPLAATARQQLLSFYADLGLPRQW
SDMGLASVSLADLQQAAILACAPESDIHHLPFAVDPDQLLAAMVSTTTPIARSNSVVAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory