Comparing Synpcc7942_2310 FitnessBrowser__SynE:Synpcc7942_2310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4rizC The crystal structure of y333q mutant pyridoxal-dependent decarboxylase from sphaerobacter thermophilus dsm 20745
54% identity, 94% coverage: 7:467/489 of query aligns to 7:474/476 of 4rizC
4rlgD The clear crystal structure of pyridoxal-dependent decarboxylase from sphaerobacter thermophilus dsm 20745
54% identity, 94% coverage: 7:467/489 of query aligns to 8:469/470 of 4rlgD
4obvC Ruminococcus gnavus tryptophan decarboxylase rumgna_01526 (alpha-fmt) (see paper)
28% identity, 85% coverage: 55:469/489 of query aligns to 46:464/471 of 4obvC
A7B1V0 Tryptophan decarboxylase; Trp decarboxylase; EC 4.1.1.105 from Ruminococcus gnavus (strain ATCC 29149 / VPI C7-9) (see paper)
28% identity, 85% coverage: 55:469/489 of query aligns to 61:482/490 of A7B1V0
Q80WP8 Acidic amino acid decarboxylase GADL1; Aspartate 1-decarboxylase; ADC; Cysteine sulfinic acid decarboxylase; CSADC; Glutamate decarboxylase-like protein 1; EC 4.1.1.11; EC 4.1.1.29 from Mus musculus (Mouse) (see paper)
31% identity, 82% coverage: 69:469/489 of query aligns to 127:549/550 of Q80WP8
4obuA Ruminococcus gnavus tryptophan decarboxylase rumgna_01526 (apo) (see paper)
28% identity, 85% coverage: 55:469/489 of query aligns to 46:454/462 of 4obuA
6enzA Crystal structure of mouse gadl1 (see paper)
31% identity, 82% coverage: 69:469/489 of query aligns to 69:486/487 of 6enzA
Q05329 Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; EC 4.1.1.15 from Homo sapiens (Human) (see 3 papers)
32% identity, 70% coverage: 66:409/489 of query aligns to 156:506/585 of Q05329
Sites not aligning to the query:
Q05683 Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; EC 4.1.1.15 from Rattus norvegicus (Rat) (see 2 papers)
31% identity, 70% coverage: 66:409/489 of query aligns to 156:506/585 of Q05683
Sites not aligning to the query:
2jisB Human cysteine sulfinic acid decarboxylase (csad) in complex with plp.
31% identity, 79% coverage: 23:409/489 of query aligns to 15:408/487 of 2jisB
3vp6A Structural characterization of glutamic acid decarboxylase; insights into the mechanism of autoinactivation (see paper)
29% identity, 72% coverage: 58:409/489 of query aligns to 58:423/500 of 3vp6A
Sites not aligning to the query:
2okjB The x-ray crystal structure of the 67kda isoform of glutamic acid decarboxylase (gad67) (see paper)
29% identity, 72% coverage: 58:409/489 of query aligns to 58:423/504 of 2okjB
Sites not aligning to the query:
Q99259 Glutamate decarboxylase 1; 67 kDa glutamic acid decarboxylase; GAD-67; Glutamate decarboxylase 67 kDa isoform; EC 4.1.1.15 from Homo sapiens (Human) (see 4 papers)
29% identity, 72% coverage: 58:409/489 of query aligns to 150:515/594 of Q99259
Sites not aligning to the query:
2okkA The x-ray crystal structure of the 65kda isoform of glutamic acid decarboxylase (gad65) (see paper)
32% identity, 70% coverage: 66:409/489 of query aligns to 69:408/483 of 2okkA
Sites not aligning to the query:
5o5cB The crystal structure of dfoj, the desferrioxamine biosynthetic pathway lysine decarboxylase from the fire blight disease pathogen erwinia amylovora (see paper)
31% identity, 82% coverage: 70:470/489 of query aligns to 62:464/468 of 5o5cB
6zekA Crystal structure of mouse csad (see paper)
32% identity, 70% coverage: 69:409/489 of query aligns to 58:399/476 of 6zekA
P14173 Aromatic-L-amino-acid decarboxylase; AADC; DOPA decarboxylase; DDC; EC 4.1.1.28 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 81% coverage: 60:457/489 of query aligns to 47:461/480 of P14173
8oraA Human holo aromatic l-amino acid decarboxylase (aadc) external aldimine with l-dopa methylester (see paper)
26% identity, 84% coverage: 59:469/489 of query aligns to 42:473/480 of 8oraA
P20711 Aromatic-L-amino-acid decarboxylase; AADC; DOPA decarboxylase; DDC; EC 4.1.1.28 from Homo sapiens (Human) (see 8 papers)
26% identity, 84% coverage: 59:469/489 of query aligns to 42:473/480 of P20711
Sites not aligning to the query:
P19113 Histidine decarboxylase; HDC; EC 4.1.1.22 from Homo sapiens (Human) (see 3 papers)
28% identity, 76% coverage: 85:456/489 of query aligns to 74:460/662 of P19113
Sites not aligning to the query:
>Synpcc7942_2310 FitnessBrowser__SynE:Synpcc7942_2310
LNSSAPLPETAFLRPDGSNREAIAAVAQLALEQLLNLGSQADQRSPVPTWQGSERHVGIP
AQSVPLPDLLQQLEPLLAQAMNPANPGYLGHMDPVASTASVIGDAIAALLNNNLLSVEMS
PSFSRLETAVLRELAQRFGLGDEAGGLLLSGGSLANLQAIALARNWALQVQETGLAGLTQ
RPILFASEAAHTSIQKAAMLLGLGSQAVIPIATDRRGRMQVAALTEAIASARRQGQRPFC
LVATAGTTVTGSIDPLPELSAIARTEGLWFHVDASYGGAVIFSPRYAHKLQGIEQANSVT
FNPQKWLCVAKTSASLLLRDWSLLTEHFRIAAPYMGEADDLINLGEVSVQGTRPADILKL
WLTLQHFGDRGCAALVEHGLRLCRCFVAELRQRPQIQVATPPDLNILCFRLASDRLTAEL
QQFLLDRYFFLSLPRFRDRLWLKAVLVNPFTTPEHIRQLFGAIDAFCRDRQIQPDPQSQD
NEITYSQSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory