SitesBLAST
Comparing Synpcc7942_2393 FitnessBrowser__SynE:Synpcc7942_2393 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8DLI5 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermosynechococcus vestitus (strain NIES-2133 / IAM M-273 / BP-1) (see paper)
64% identity, 100% coverage: 1:480/481 of query aligns to 1:482/485 of Q8DLI5
- R6 (= R6) binding
- Y192 (= Y192) binding
2cfoA Non-discriminating glutamyl-tRNA synthetase from thermosynechococcus elongatus in complex with glu (see paper)
64% identity, 100% coverage: 2:480/481 of query aligns to 1:481/484 of 2cfoA
P04805 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Escherichia coli (strain K12) (see 4 papers)
40% identity, 98% coverage: 1:469/481 of query aligns to 1:452/471 of P04805
- C98 (= C98) mutation to S: 10-fold decrease in activity. Strong decrease in zinc content.
- C100 (= C100) mutation to S: Loss of activity. Strong decrease in zinc content.; mutation to Y: Does not prevent zinc binding. Reduces only 2-fold the binding affinity for tRNA(Glu), but reduces more than 10-fold the affinity for glutamate in the presence of tRNA(Glu).
- C125 (≠ H125) mutation to S: Loss of activity. Strong decrease in zinc content.
- H127 (≠ Q132) mutation to Q: 10-fold decrease in activity. Strong decrease in zinc content.
- H129 (≠ A134) mutation to Q: No change in activity or in zinc content.
- H131 (≠ F136) mutation to Q: No change in activity or in zinc content.
- H132 (≠ Q137) mutation to Q: No change in activity or in zinc content.
- C138 (≠ A143) mutation to S: No change in activity or in zinc content.
- S239 (= S250) modified: Phosphoserine; mutation to D: Does not aminoacylate tRNA(Glu), not phosphorylated by HipA.
8i9iA Glutamyl-tRNA synthetase from escherichia coli bound to glutamate and zinc
40% identity, 98% coverage: 1:469/481 of query aligns to 1:452/468 of 8i9iA
4g6zA Crystal structure of a glutamyl-tRNA synthetase glurs from burkholderia thailandensis bound to l-glutamate (see paper)
42% identity, 79% coverage: 3:380/481 of query aligns to 3:353/380 of 4g6zA
4griB Crystal structure of a glutamyl-tRNA synthetase glurs from borrelia burgdorferi bound to glutamic acid and zinc (see paper)
38% identity, 79% coverage: 2:380/481 of query aligns to 1:384/485 of 4griB
- active site: S9 (= S10), K253 (= K251)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (= E42), Y194 (= Y192), R212 (= R210), W216 (≠ H214)
- binding zinc ion: C105 (= C98), C107 (= C100), Y128 (= Y121), C132 (≠ H125)
8vc5A Crystal structure of glutamyl-tRNA synthetase glurs from pseudomonas aeruginosa (zinc bound)
38% identity, 86% coverage: 1:412/481 of query aligns to 2:402/488 of 8vc5A
2cv2A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu) and an enzyme inhibitor, glu-ams (see paper)
35% identity, 99% coverage: 3:477/481 of query aligns to 2:468/468 of 2cv2A
- active site: K246 (= K251)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R5 (= R6), A7 (= A8), S9 (= S10), G17 (= G18), I21 (≠ T22), E41 (= E42), Y187 (= Y192), R205 (= R210), A206 (≠ G211), E208 (≠ D213), W209 (≠ H214), L235 (= L240), L236 (≠ I241)
- binding : S9 (= S10), T43 (= T44), D44 (= D45), R47 (= R48), V145 (= V144), R163 (= R162), Y168 (≠ W167), E172 (≠ D171), V177 (= V177), K180 (≠ R180), S181 (≠ T186), Y187 (= Y192), E207 (= E212), E208 (≠ D213), W209 (≠ H214), V211 (≠ A216), R237 (≠ L242), K241 (≠ G246), L272 (= L277), M273 (≠ L278), G274 (= G279), E282 (= E288), S299 (≠ N305), P303 (≠ A309), V304 (≠ K310), K309 (= K315), W312 (= W318), R319 (≠ K325), P357 (= P364), R358 (≠ S365), R417 (≠ D425), Q432 (≠ R440), R435 (= R443), L442 (≠ M450), E443 (≠ Q451), T444 (≠ G452), G446 (≠ D454), L447 (= L455), F448 (≠ L456)
2cv1A Glutamyl-tRNA synthetase from thermus thermophilus in complex with tRNA(glu), atp, and an analog of l-glutamate: a quaternary complex
35% identity, 99% coverage: 3:477/481 of query aligns to 2:468/468 of 2cv1A
- active site: K246 (= K251)
- binding adenosine-5'-triphosphate: P8 (= P9), S9 (= S10), G17 (= G18), T18 (= T19), I21 (≠ T22), R47 (= R48), A206 (≠ G211), W209 (≠ H214), L235 (= L240), L236 (≠ I241)
- binding (4s)-4-amino-5-hydroxypentanoic acid: R5 (= R6), A7 (= A8), E41 (= E42), Y187 (= Y192), R205 (= R210), W209 (≠ H214)
- binding : S9 (= S10), E41 (= E42), T43 (= T44), D44 (= D45), R47 (= R48), V145 (= V144), R163 (= R162), V166 (= V165), E172 (≠ D171), V177 (= V177), K180 (≠ R180), S181 (≠ T186), Y187 (= Y192), E207 (= E212), E208 (≠ D213), W209 (≠ H214), V211 (≠ A216), R237 (≠ L242), K241 (≠ G246), K243 (= K248), M273 (≠ L278), G274 (= G279), S276 (= S281), E282 (= E288), S299 (≠ N305), P303 (≠ A309), V304 (≠ K310), K309 (= K315), W312 (= W318), R319 (≠ K325), P357 (= P364), R358 (≠ S365), R417 (≠ D425), L427 (≠ K435), Q432 (≠ R440), R435 (= R443), L442 (≠ M450), E443 (≠ Q451), T444 (≠ G452), G446 (≠ D454), L447 (= L455), F448 (≠ L456)
2cuzA Glutamyl-tRNA synthetase from thermus thermophilus in complex with l-glutamate (see paper)
35% identity, 99% coverage: 3:477/481 of query aligns to 2:468/468 of 2cuzA
1n78A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with tRNA(glu) and glutamol-amp. (see paper)
35% identity, 99% coverage: 3:477/481 of query aligns to 2:468/468 of 1n78A
- active site: K246 (= K251)
- binding glutamol-amp: R5 (= R6), A7 (= A8), P8 (= P9), S9 (= S10), G17 (= G18), T18 (= T19), I21 (≠ T22), E41 (= E42), Y187 (= Y192), N191 (≠ V196), R205 (= R210), A206 (≠ G211), E208 (≠ D213), W209 (≠ H214), L235 (= L240), L236 (≠ I241)
- binding : S9 (= S10), T43 (= T44), D44 (= D45), R47 (= R48), V145 (= V144), R163 (= R162), V166 (= V165), Y168 (≠ W167), E172 (≠ D171), V177 (= V177), K180 (≠ R180), S181 (≠ T186), Y187 (= Y192), E207 (= E212), E208 (≠ D213), W209 (≠ H214), L210 (≠ I215), V211 (≠ A216), R237 (≠ L242), K241 (≠ G246), M273 (≠ L278), G274 (= G279), E282 (= E288), R297 (= R303), P303 (≠ A309), V304 (≠ K310), K309 (= K315), W312 (= W318), R319 (≠ K325), P357 (= P364), R358 (≠ S365), R417 (≠ D425), L427 (≠ K435), Q432 (≠ R440), R435 (= R443), L442 (≠ M450), E443 (≠ Q451), T444 (≠ G452), G446 (≠ D454), L447 (= L455), F448 (≠ L456)
1j09A Crystal structure of thermus thermophilus glutamyl-tRNA synthetase complexed with atp and glu (see paper)
35% identity, 99% coverage: 3:477/481 of query aligns to 2:468/468 of 1j09A
- active site: K246 (= K251)
- binding adenosine-5'-triphosphate: H15 (= H16), E208 (≠ D213), L235 (= L240), L236 (≠ I241), K243 (= K248), I244 (≠ L249), S245 (= S250), K246 (= K251), R247 (= R252)
- binding glutamic acid: R5 (= R6), A7 (= A8), S9 (= S10), E41 (= E42), Y187 (= Y192), N191 (≠ V196), R205 (= R210), W209 (≠ H214)
P27000 Glutamate--tRNA ligase; Glutamyl-tRNA synthetase; GluRS; EC 6.1.1.17 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
35% identity, 99% coverage: 3:477/481 of query aligns to 2:468/468 of P27000
- R358 (≠ S365) mutation to Q: Reduces affinity for tRNA and abolishes the ability to discriminate between tRNA(Glu) and tRNA(Gln).
1g59A Glutamyl-tRNA synthetase complexed with tRNA(glu). (see paper)
35% identity, 99% coverage: 3:477/481 of query aligns to 2:468/468 of 1g59A
- binding : D44 (= D45), R45 (≠ L46), A46 (≠ E47), R47 (= R48), P109 (≠ E102), V145 (= V144), R163 (= R162), V166 (= V165), E172 (≠ D171), V177 (= V177), K180 (≠ R180), S181 (≠ T186), D182 (≠ I187), E207 (= E212), E208 (≠ D213), R237 (≠ L242), K241 (≠ G246), T242 (≠ R247), K243 (= K248), M273 (≠ L278), G274 (= G279), E282 (= E288), S299 (≠ N305), L300 (≠ K306), P303 (≠ A309), V304 (≠ K310), K309 (= K315), W312 (= W318), R319 (≠ K325), P357 (= P364), R358 (≠ S365), R417 (≠ D425), K426 (= K434), L427 (≠ K435), Q432 (≠ R440), R435 (= R443), L442 (≠ M450), E443 (≠ Q451), T444 (≠ G452), P445 (= P453), G446 (≠ D454), L447 (= L455), F448 (≠ L456)
3al0C Crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. (see paper)
35% identity, 96% coverage: 3:462/481 of query aligns to 103:546/564 of 3al0C
- active site: S110 (= S10), K335 (= K251)
- binding o5'-(l-glutamyl-sulfamoyl)-adenosine: R106 (= R6), A108 (= A8), P109 (= P9), G118 (= G18), T122 (= T22), E142 (= E42), Y276 (= Y192), R294 (= R210), G295 (= G211), D297 (= D213), H298 (= H214), L324 (= L240), I325 (= I241), L333 (= L249)
- binding : T144 (= T44), D145 (= D45), R148 (= R48), Y208 (≠ C100), P213 (= P119), K252 (≠ R162), M255 (≠ V165), I266 (≠ V177), K269 (≠ R180), S270 (≠ R181), Y276 (= Y192), D297 (= D213), H298 (= H214), L299 (≠ I215), S300 (≠ A216), N301 (= N217), K304 (= K220), R330 (≠ G246), P332 (≠ K248), G363 (= G279), W364 (= W280), R365 (≠ S281), E370 (= E288), S387 (≠ N305), K389 (≠ A307), V391 (≠ A309), I392 (≠ K310), K397 (= K315), W400 (= W318), R407 (≠ K325), E446 (≠ P364), K447 (≠ S365), Q453 (≠ D371), I457 (≠ Q375), R509 (≠ I424), K520 (= K435), Q524 (≠ R440), R527 (= R443), V535 (≠ Q451), T536 (≠ G452), G538 (≠ D454), L539 (= L455)
6brlA Crystal structure of a glutamate tRNA ligase from elizabethkingia meningosepticum ccug26117 in complex with its amino acid
34% identity, 94% coverage: 3:455/481 of query aligns to 3:478/502 of 6brlA
P27305 Glutamyl-Q tRNA(Asp) synthetase; Glu-Q-RSs; EC 6.1.1.- from Escherichia coli (strain K12) (see paper)
36% identity, 53% coverage: 6:258/481 of query aligns to 19:248/308 of P27305
- E55 (= E42) binding
- Y182 (= Y192) binding
- R200 (= R210) binding
4a91A Crystal structure of the glutamyl-queuosine trnaasp synthetase from e. Coli complexed with l-glutamate (see paper)
36% identity, 51% coverage: 6:252/481 of query aligns to 7:230/290 of 4a91A
- active site: S11 (= S10), K229 (= K251)
- binding glutamic acid: R7 (= R6), A9 (= A8), S11 (= S10), E43 (= E42), Y170 (= Y192), R188 (= R210), L192 (≠ H214)
- binding zinc ion: C99 (= C98), C101 (= C100), Y113 (= Y121), C117 (≠ H125)
3aiiA Archaeal non-discriminating glutamyl-tRNA synthetase from methanothermobacter thermautotrophicus (see paper)
31% identity, 69% coverage: 3:334/481 of query aligns to 11:309/455 of 3aiiA
P46655 Glutamate--tRNA ligase, cytoplasmic; Glutamyl-tRNA synthetase; (c)ERS; GluRS; P85; EC 6.1.1.17 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 47% coverage: 3:228/481 of query aligns to 202:418/708 of P46655
Sites not aligning to the query:
- 148 R→A: Abolishes interaction with ARC1.
Query Sequence
>Synpcc7942_2393 FitnessBrowser__SynE:Synpcc7942_2393
VSVRVRIAPSPTGNLHIGTARTAVFNWLFARRHQGQFILRIEDTDLERSRSEYTDNILTG
LQWLGLNWDEGPFYQTQRLDLYKAAVQQLLDSGKAYRCYCTEAELEALRESQRARNEAPR
YDNRHRDLTPEQEAAFQAEGREAVIRFRIDDDREIAWTDLVRDRVVWKGSDLGGDMVIAR
RSPAGTIGQPLYNLAVVVDDIDMTISHVIRGEDHIANTAKQILLYEALGAAVPEFAHTPL
ILNKEGRKLSKRDGVTSISDFQNLGYLPEAIANYMTLLGWSPVEGMDERFSLAEAATVFD
FDRVNKAGAKFDWDKLNWLNSQVIKEKSASELVALLQPFWSKAGVDTAAYPAAWLEELAT
LLGPSLVTLTDIVGQSQLFFSQGIELQEDAIAQLGQAGSKAVLQQILEALPSEALTLEVA
KGLIDQAVKAAGVKKGIGMRSLRAALMGSMQGPDLLTSWVLLHQAGQAQPRLQAAIAAAQ
G
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory