Comparing Synpcc7942_2402 FitnessBrowser__SynE:Synpcc7942_2402 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
6b2wA C. Jejuni c315s agmatine deiminase with substrate bound (see paper)
35% identity, 88% coverage: 42:373/376 of query aligns to 15:332/333 of 6b2wA
Q8GWW7 Agmatine deiminase; Agmatine iminohydrolase; Protein EMBRYO DEFECTIVE 1873; EC 3.5.3.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 89% coverage: 39:371/376 of query aligns to 15:373/383 of Q8GWW7
3h7cX Crystal structure of arabidopsis thaliana agmatine deiminase from cell free expression
30% identity, 89% coverage: 39:371/376 of query aligns to 15:366/369 of 3h7cX
6nicD Crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide (see paper)
30% identity, 89% coverage: 38:371/376 of query aligns to 4:359/360 of 6nicD
Q837U5 Putative agmatine deiminase; Agmatine iminohydrolase; EC 3.5.3.12 from Enterococcus faecalis (strain ATCC 700802 / V583) (see paper)
31% identity, 91% coverage: 28:370/376 of query aligns to 6:363/365 of Q837U5
G7JT50 Agmatine deiminase; Agmatine iminohydrolase; MtAIH; EC 3.5.3.12 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
29% identity, 89% coverage: 38:371/376 of query aligns to 14:373/374 of G7JT50
>Synpcc7942_2402 FitnessBrowser__SynE:Synpcc7942_2402
MRGDFAPNDRTQTTEAARLNKGLFASQIMSQGQQSDRRFPAEWEAQDGVLIAWPHADSDW
RSLLDQVDRVYRDLAEAVTRFEQLLIVTPEPDRVAEQLAQTTANCDRIQIVELPTNDTWS
RDFGPLTVETPAGLRLLDWGFNGWGLKFAANHDNQVTRRLWQQGIFGTTPLETVPLIFEG
GSIESDGRGTLLTTSQCLLEANRNPGLSREAIAQIIQRQLGGDRLLWLEHGHLEGDDTDA
HIDTLVRIAPNDTLIYVACDDPSDSHAAELTALEAELKALRAADGQPYHLIPLPWPQPCF
DADGQRLPTTYANYLVINGAVLVPTYNDPADEAAIAAIAAAFPDRLAIGINCRPLLEQHG
SLHCITMQLPAGLLSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory