Comparing Synpcc7942_2454 FitnessBrowser__SynE:Synpcc7942_2454 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5yw5A Crystal structure of adenine phosphoribosyltransferase from francisella tularensis in complex with adenine (see paper)
59% identity, 37% coverage: 3:157/424 of query aligns to 9:165/178 of 5yw5A
7y94B Crystal structure of escherichia coli adenine phosphoribosyltransferase (aprt) in complex with adenine
55% identity, 41% coverage: 3:174/424 of query aligns to 11:180/183 of 7y94B
Sites not aligning to the query:
5b6hA Crystal structure of an aprt from yersinia pseudotuberculosis in complex with amp.
52% identity, 41% coverage: 3:174/424 of query aligns to 9:178/179 of 5b6hA
5y07A Crystal structure of adenine phosphoribosyltransferase from yersinia pseudotuberculosis with prpp.
52% identity, 41% coverage: 3:174/424 of query aligns to 8:177/179 of 5y07A
5znqA Crystal structure of aprt from y. Pseudotuberculosis with bound adenine (p21 space group).
52% identity, 41% coverage: 3:174/424 of query aligns to 11:180/183 of 5znqA
Sites not aligning to the query:
4m0kC Crystal structure of adenine phosphoribosyltransferase from rhodothermus marinus dsm 4252, nysgrc target 029775.
56% identity, 37% coverage: 3:158/424 of query aligns to 8:163/176 of 4m0kC
P31166 Adenine phosphoribosyltransferase 1, chloroplastic; APRT 1; AtAPT1; EC 2.4.2.7 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
46% identity, 37% coverage: 3:158/424 of query aligns to 74:229/243 of P31166
P07741 Adenine phosphoribosyltransferase; APRT; EC 2.4.2.7 from Homo sapiens (Human) (see 8 papers)
49% identity, 36% coverage: 7:158/424 of query aligns to 13:167/180 of P07741
Sites not aligning to the query:
1zn7A Human adenine phosphoribosyltransferase complexed with prpp, ade and r5p (see paper)
49% identity, 36% coverage: 7:158/424 of query aligns to 11:165/178 of 1zn7A
6hgqA Crystal structure of human aprt wild type in complex with hypoxanthine, prpp and mg2+ (see paper)
49% identity, 36% coverage: 7:158/424 of query aligns to 12:166/179 of 6hgqA
6fciA Crystal structure of human aprt wild type in complex with adenine, prpp and mg2+ (see paper)
49% identity, 36% coverage: 7:158/424 of query aligns to 12:166/179 of 6fciA
1oreA Human adenine phosphoribosyltransferase (see paper)
49% identity, 36% coverage: 7:158/424 of query aligns to 12:166/179 of 1oreA
P36972 Adenine phosphoribosyltransferase; APRT; EC 2.4.2.7 from Rattus norvegicus (Rat)
48% identity, 36% coverage: 7:158/424 of query aligns to 13:167/180 of P36972
Sites not aligning to the query:
6hgsA Crystal structure of human aprt wild type in complex with gmp (see paper)
48% identity, 36% coverage: 7:158/424 of query aligns to 11:163/176 of 6hgsA
6hgpA Crystal structure of human aprt wild type in complex with phosphate ion. (see paper)
47% identity, 36% coverage: 7:158/424 of query aligns to 11:162/175 of 6hgpA
6hgrA Crystal structure of human aprt wild type in complex with imp (see paper)
47% identity, 36% coverage: 7:158/424 of query aligns to 11:160/173 of 6hgrA
6fd5A Crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 14 days post crystallization (with amp and ppi products partially generated) (see paper)
47% identity, 36% coverage: 7:158/424 of query aligns to 11:160/173 of 6fd5A
P49435 Adenine phosphoribosyltransferase 1; APRT 1; EC 2.4.2.7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
44% identity, 37% coverage: 2:158/424 of query aligns to 9:169/187 of P49435
5vjnA Crystal structure of adenine phosphoribosyltransferase from saccharomyces cerevisiae complexed with d-2,5-dideoxy-2,5-imino- altritol 1,6-bisphosphate (d-diab) and adenine (see paper)
44% identity, 37% coverage: 2:158/424 of query aligns to 7:167/176 of 5vjnA
5vjpB Crystal structure of adenine phosphoribosyltransferase from saccharomyces cerevisiae complexed with l-2,5-dideoxy-2,5-imino- altritol 1,6-bisphosphate (l-diab) and adenine (see paper)
44% identity, 37% coverage: 2:158/424 of query aligns to 9:169/179 of 5vjpB
>Synpcc7942_2454 FitnessBrowser__SynE:Synpcc7942_2454
MDLKTLIREIPDFPKPGILFRDYTTVLKDPQGWRYSIDRLTELIKPLEPTAIVGIESRGF
ILGAPLAYQLGLGFVPVRKPGKLPADTHSVEYELEYGSDRLEIHQDALAPGDRVVVVDDL
IATGGTASATATLIDRCSATLAGFAFVIELEGLNGRDRPWLEQYGRWLWQVVRYGNFGSS
FVYQRPVADLLWERVPNTLLLAICSLITTWAIALPLGIQAAVAQNQRSDRILQLISYLGQ
GTPSFITALLLLFLAQFLTPLLPIGGMTSLDFEDLTPLQQMADLGRHLILPVLALTLSGF
ASLQRISRGEMLEVLRQDYIRTARAKGLPEQRVIYVHALRNAINPLITLLGFEFATLLSG
AFIAEYFFNWPGLGRLILQAVFAQDLYLVMASLMMGAVMLILGNLLADLLLRWVDPRIRL
DDLN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory