Comparing Synpcc7942_2461 FitnessBrowser__SynE:Synpcc7942_2461 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
6nicD Crystal structure of medicago truncatula agmatine iminohydrolase (deiminase) in complex with 6-aminohexanamide (see paper)
28% identity, 82% coverage: 65:456/477 of query aligns to 3:360/360 of 6nicD
G7JT50 Agmatine deiminase; Agmatine iminohydrolase; MtAIH; EC 3.5.3.12 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
28% identity, 82% coverage: 65:456/477 of query aligns to 13:374/374 of G7JT50
3h7cX Crystal structure of arabidopsis thaliana agmatine deiminase from cell free expression
29% identity, 82% coverage: 65:453/477 of query aligns to 13:364/369 of 3h7cX
Q837U5 Putative agmatine deiminase; Agmatine iminohydrolase; EC 3.5.3.12 from Enterococcus faecalis (strain ATCC 700802 / V583) (see paper)
30% identity, 82% coverage: 65:453/477 of query aligns to 15:362/365 of Q837U5
Q8GWW7 Agmatine deiminase; Agmatine iminohydrolase; Protein EMBRYO DEFECTIVE 1873; EC 3.5.3.12 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 82% coverage: 65:453/477 of query aligns to 13:371/383 of Q8GWW7
6b2wA C. Jejuni c315s agmatine deiminase with substrate bound (see paper)
27% identity, 65% coverage: 145:453/477 of query aligns to 85:328/333 of 6b2wA
>Synpcc7942_2461 FitnessBrowser__SynE:Synpcc7942_2461
MNQKLSRFPKSSWAYVVIACSIAIALIFSSPVKAKLPLGDRLTWGNAVTETSPAYRQALN
QAKTFRMPAEFEPITSIWMAYPTYENQAGYPSQTVQKAMVKAIAPTVKIDFLLNEPEEKV
IINGWLKTAGIPASQVRYHLVPHEDLWIRDMGPIFAVNADQTQVVDFGFNAWSYLAATDP
AAMTDEQVDRKVAGDLDLPILRSSLISEGGNREFNGKGTLMLTEAVELQRNPGLTKEKIE
TELKRVFNLKKVIWLQEGVIDDELSYRGKLPDGSLTVLATGGHIDEYARFVDSNTILLAE
VTAEERASDPLAAINYQRLEENLKILQAATDQDGKPFRIVRIPAAKPIYVNMTKEDAVFQ
ALQELTFEDGTVIQDDDQIKTILAASYLNFVIANDVVIVPRYWQPDRNLEYQQKDQAALA
AFQSVFPNKKIVAINPENINAGGGGMHCIVQQQAVVDAVARSLSTGAGDRSKSRSNL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory