Comparing Synpcc7942_2492 FitnessBrowser__SynE:Synpcc7942_2492 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
54% identity, 100% coverage: 1:237/237 of query aligns to 2:238/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
31% identity, 98% coverage: 5:237/237 of query aligns to 2:235/240 of 6mjpA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 98% coverage: 5:237/237 of query aligns to 4:253/254 of 1g6hA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
35% identity, 98% coverage: 6:237/237 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
35% identity, 98% coverage: 6:237/237 of query aligns to 3:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
35% identity, 98% coverage: 6:237/237 of query aligns to 3:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
34% identity, 98% coverage: 6:237/237 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
34% identity, 97% coverage: 6:236/237 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
34% identity, 97% coverage: 6:236/237 of query aligns to 3:234/234 of 4p31A
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 98% coverage: 5:237/237 of query aligns to 4:253/253 of 1g9xB
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
34% identity, 97% coverage: 6:235/237 of query aligns to 3:233/233 of 6b8bA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 96% coverage: 4:230/237 of query aligns to 1:228/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
28% identity, 94% coverage: 5:226/237 of query aligns to 1:224/240 of 4ymuJ
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 96% coverage: 4:230/237 of query aligns to 16:240/378 of P69874
Sites not aligning to the query:
Q5SSE9 ATP-binding cassette sub-family A member 13; EC 7.6.2.- from Mus musculus (Mouse) (see paper)
32% identity, 87% coverage: 19:225/237 of query aligns to 3824:4029/5034 of Q5SSE9
Sites not aligning to the query:
7qkrA Cryo-em structure of abc transporter ste6-2p from pichia pastoris with verapamil at 3.2 a resolution (see paper)
34% identity, 87% coverage: 21:226/237 of query aligns to 978:1182/1199 of 7qkrA
Sites not aligning to the query:
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
27% identity, 97% coverage: 3:232/237 of query aligns to 2:235/501 of P04983
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
26% identity, 94% coverage: 3:225/237 of query aligns to 2:223/285 of 4yerA
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
29% identity, 95% coverage: 6:229/237 of query aligns to 4:225/369 of P19566
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
29% identity, 93% coverage: 9:229/237 of query aligns to 30:254/382 of 7ahhC
Sites not aligning to the query:
>Synpcc7942_2492 FitnessBrowser__SynE:Synpcc7942_2492
MSEPLLQLSQIAVNYGAVVALTDLTLEIFPGEIVALIGANGAGKSTTLRAISRLVPLQQG
RIYYDQQDLGLIPAPQLVGRGLAHCPEGRRVLARQSVRINLELGAYCRRDRIGIQTDLEL
QFDRFPRLRERQNQPAGTLSGGEQQMLAIARALMSRPRLLLLDEPSLGLAPQIVQEIFSV
IRSLREQGMTILLVEQNATLALQTADRGYVLEAGQLLFSGPAADLLIDPRVKQAYLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory