SitesBLAST
Comparing Synpcc7942_2514 FitnessBrowser__SynE:Synpcc7942_2514 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
51% identity, 100% coverage: 1:305/305 of query aligns to 3:313/315 of Q51742
- W22 (≠ L20) mutation to A: Decreased heat stability.
- E26 (= E24) mutation to Q: Increased dissociation of dodecamers into trimers.
- M30 (≠ T28) mutation to A: Increased dissociation of dodecamers into trimers.
- W34 (≠ G32) mutation to A: Increased dissociation of dodecamers into trimers.
- Y228 (= Y220) mutation to C: Becomes active at low temperatures; when associated with G-278.
- A241 (= A233) mutation to D: Becomes active at low temperatures; when associated with G-278.
- E278 (= E270) mutation to G: Becomes active at low temperatures; when associated with C-228 or D-241.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
52% identity, 99% coverage: 3:305/305 of query aligns to 9:312/316 of Q81M99
4nf2A Crystal structure of anabolic ornithine carbamoyltransferase from bacillus anthracis in complex with carbamoyl phosphate and l- norvaline
52% identity, 98% coverage: 3:302/305 of query aligns to 5:305/307 of 4nf2A
- active site: R55 (= R52), T56 (= T53), R83 (= R80), R104 (= R101), H131 (= H128), Q134 (= Q131), D226 (= D222), C265 (= C262), R293 (= R290)
- binding phosphoric acid mono(formamide)ester: S53 (= S50), T54 (= T51), R55 (= R52), T56 (= T53), R104 (= R101), H131 (= H128), Q134 (= Q131), C265 (= C262), L266 (= L263), R293 (= R290)
- binding norvaline: L126 (= L123), N162 (= N159), D226 (= D222), S230 (= S226), M231 (= M227)
P9WIT9 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
52% identity, 97% coverage: 6:302/305 of query aligns to 3:304/307 of P9WIT9
2i6uA Crystal structure of ornithine carbamoyltransferase complexed with carbamoyl phosphate and l-norvaline from mycobacterium tuberculosis (rv1656) at 2.2 a (see paper)
52% identity, 97% coverage: 6:302/305 of query aligns to 3:304/307 of 2i6uA
- active site: R52 (= R52), T53 (= T53), R80 (= R80), R101 (= R101), H128 (= H128), Q131 (= Q131), D224 (= D222), C264 (= C262), R292 (= R290)
- binding phosphoric acid mono(formamide)ester: S50 (= S50), T51 (= T51), R52 (= R52), T53 (= T53), R101 (= R101), C264 (= C262), L265 (= L263), R292 (= R290)
- binding norvaline: L123 (= L123), N160 (= N159), D224 (= D222), S228 (= S226), M229 (= M227)
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
52% identity, 97% coverage: 6:302/305 of query aligns to 4:305/308 of 7nouA
- active site: R102 (= R101), H129 (= H128), Q132 (= Q131), D225 (= D222), C265 (= C262), R293 (= R290)
- binding [3,5-bis(chloranyl)phenyl]-oxidanyl-oxidanylidene-boron: I46 (= I45), T52 (= T51), R53 (= R52), R53 (= R52), F56 (≠ V55), F56 (≠ V55), L79 (≠ V78), D82 (≠ G81), E83 (= E82), V91 (= V90), Y95 (= Y94), L266 (= L263), R293 (= R290)
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
52% identity, 97% coverage: 6:302/305 of query aligns to 4:305/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
52% identity, 97% coverage: 6:302/305 of query aligns to 4:305/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
52% identity, 97% coverage: 6:302/305 of query aligns to 4:305/308 of 7nnyA
- active site: R102 (= R101), H129 (= H128), Q132 (= Q131), D225 (= D222), C265 (= C262), R293 (= R290)
- binding 1-naphthol: T52 (= T51), R53 (= R52), F56 (≠ V55), E83 (= E82), V91 (= V90), Y95 (= Y94)
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
52% identity, 97% coverage: 6:302/305 of query aligns to 4:305/308 of 7nnwA
- active site: R102 (= R101), H129 (= H128), Q132 (= Q131), D225 (= D222), C265 (= C262), R293 (= R290)
- binding methyl 3-iodanyl-4-oxidanyl-benzoate: I46 (= I45), T52 (= T51), R53 (= R52), F56 (≠ V55), L79 (≠ V78), L92 (= L91), Y95 (= Y94)
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
52% identity, 97% coverage: 6:302/305 of query aligns to 4:305/308 of 7nnvA
- active site: R102 (= R101), H129 (= H128), Q132 (= Q131), D225 (= D222), C265 (= C262), R293 (= R290)
- binding phosphoric acid mono(formamide)ester: S51 (= S50), T52 (= T51), R53 (= R52), T54 (= T53), R102 (= R101), H129 (= H128), C265 (= C262), L266 (= L263), R293 (= R290)
7np0A Crystal structure of mycobacterium tuberculosis argf in complex with (4-nitrophenyl)boronic acid.
52% identity, 97% coverage: 6:302/305 of query aligns to 4:302/305 of 7np0A
7novA Crystal structure of mycobacterium tuberculosis argf in complex with (4-methyl-3-nitrophenyl)boronic acid.
51% identity, 97% coverage: 6:302/305 of query aligns to 4:299/302 of 7novA
- active site: R96 (= R101), H123 (= H128), Q126 (= Q131), D219 (= D222), C259 (= C262), R287 (= R290)
- binding (4-methyl-3-nitro-phenyl)-oxidanyl-oxidanylidene-boron: R53 (= R52), F56 (≠ V55), E77 (= E82), V85 (= V90), Y89 (= Y94), L260 (= L263), A284 (= A287), R287 (= R290)
7nnzB Crystal structure of mycobacterium tuberculosis argf in complex with 5-methyl-4-phenylthiazol-2-amine.
51% identity, 97% coverage: 6:302/305 of query aligns to 3:294/297 of 7nnzB
8qeuA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with ornithine (see paper)
46% identity, 98% coverage: 6:303/305 of query aligns to 2:303/304 of 8qeuA
8qevA Crystal structure of ornithine transcarbamylase from arabidopsis thaliana (atotc) in complex with carbamoyl phosphate (see paper)
44% identity, 98% coverage: 6:303/305 of query aligns to 2:296/297 of 8qevA
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
41% identity, 98% coverage: 3:302/305 of query aligns to 37:342/354 of P00481
- R92 (= R52) mutation to L: Strong decrease in ornithine carbamoyltransferase activity.
- C303 (= C262) mutation to S: Increases KM for ornithine 5-fold and decreases kcat 20-fold.
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
P00480 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Homo sapiens (Human) (see 31 papers)
41% identity, 98% coverage: 3:302/305 of query aligns to 37:342/354 of P00480
- G39 (= G5) to C: in OTCD; late onset; dbSNP:rs72554306
- R40 (= R6) to H: in OTCD; late onset; dbSNP:rs72554308
- L43 (= L9) to F: in dbSNP:rs72554309
- K46 (≠ A12) to R: in dbSNP:rs1800321
- Y55 (≠ E21) to D: in OTCD; late onset; dbSNP:rs72554319
- L63 (= L29) to P: in OTCD; late onset; dbSNP:rs72554324
- K88 (= K48) modified: N6-acetyllysine; alternate; to N: in OTCD; late onset; dbSNP:rs72554339
- STRT 90:93 (= STRT 50:53) binding
- G100 (≠ A60) to D: in OTCD; late onset; dbSNP:rs72554349
- F101 (≠ I61) to L: in dbSNP:rs1133135
- L111 (= L71) to P: in dbSNP:rs1800324
- T125 (≠ A85) to M: in OTCD; neonatal; dbSNP:rs72554356
- D126 (= D86) to G: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; 0.9% of wild-type activity; dbSNP:rs72554358
- R129 (= R89) to H: in OTCD; early onset; decreased ornithine carbamoyltransferase activity; 2.1% of wild-type activity; dbSNP:rs66656800
- A140 (≠ I100) to P: in OTCD; late onset; dbSNP:rs72556260
- R141 (= R101) binding ; to Q: in OTCD; most common variant; loss of ornithine carbamoyltransferase activity; activity is 100-fold lower; dbSNP:rs68026851
- H168 (= H128) binding
- Q171 (= Q131) binding
- I172 (= I132) to M: in OTCD; early onset; loss of ornithine carbamoyltransferase activity; dbSNP:rs72556280
- Y176 (≠ L136) to C: in OTCD; late onset; dbSNP:rs72556283
- TL 178:179 (≠ TI 138:139) natural variant: Missing (in OTCD; neonatal)
- Y183 (≠ F143) to D: in OTCD; late onset; dbSNP:rs72556292
- G188 (≠ D148) to R: in OTCD; neonatal; dbSNP:rs72556294
- G195 (= G155) to R: in OTCD; loss of ornithine carbamoyltransferase activity; dbSNP:rs67294955
- D196 (= D156) to V: in OTCD; neonatal; decreased ornithine carbamoyltransferase activity; 3.7% activity; dbSNP:rs72556300
- L201 (≠ A161) to P: in OTCD; neonatal; dbSNP:rs72558407
- S207 (≠ G167) to R: in OTCD; neonatal; dbSNP:rs72558415
- A209 (= A169) to V: in OTCD; neonatal; dbSNP:rs72558417
- M213 (= M173) to K: in OTCD; late onset
- H214 (≠ N174) to Y: in OTCD; neonatal; dbSNP:rs72558420
- P220 (= P180) to A: in OTCD; late onset; dbSNP:rs72558425
- P225 (= P185) to T: in OTCD; late onset; dbSNP:rs72558428
- L244 (≠ V203) to Q: in OTCD; late onset; dbSNP:rs72558436
- T262 (= T221) to K: in OTCD; mild; dbSNP:rs67333670
- T264 (≠ V223) to A: in OTCD; late onset; decreased ornithine carbamoyltransferase activity; 8.9% activity; dbSNP:rs72558444; to I: in OTCD; late onset; dbSNP:rs67156896
- W265 (= W224) to L: in OTCD; mild; dbSNP:rs72558446
- G269 (= G228) to E: in OTCD; neonatal; dbSNP:rs72558450
- Q270 (= Q229) to R: in dbSNP:rs1800328
- E272 (= E231) natural variant: Missing (in OTCD; late onset; dbSNP:rs72558452)
- R277 (= R236) to Q: in OTCD; late onset; dbSNP:rs66724222; to W: in OTCD; late onset; dbSNP:rs72558454
- H302 (= H261) to L: in OTCD; female; late onset; dbSNP:rs67993095; to Y: in OTCD; neonatal; dbSNP:rs72558463
- C303 (= C262) to R: in OTCD; neonatal; dbSNP:rs67468335
- CL 303:304 (= CL 262:263) binding
- E309 (= E269) natural variant: Missing (in OTCD; late onset)
- R330 (= R290) binding
- T333 (≠ A293) natural variant: T -> A
- S340 (≠ L300) to P: in OTCD; late onset; dbSNP:rs72558489
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 15 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-23 and G-26.
- 23 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-26.
- 26 R→G: Loss of cleavage of the transit peptide and loss of localization to mitochondrial matrix; when associated with G-15 and G-23.
- 343 T → K: in OTCD; late onset; dbSNP:rs72558491
1othA Crystal structure of human ornithine transcarbamoylase complexed with n-phosphonacetyl-l-ornithine (see paper)
41% identity, 98% coverage: 3:302/305 of query aligns to 4:309/321 of 1othA
- active site: R59 (= R52), T60 (= T53), V87 (≠ R80), R108 (= R101), H135 (= H128), Q138 (= Q131), D230 (= D222), C270 (= C262), R297 (= R290)
- binding n-(phosphonoacetyl)-l-ornithine: S57 (= S50), T58 (= T51), R59 (= R52), T60 (= T53), R108 (= R101), L130 (= L123), H135 (= H128), N166 (= N159), D230 (= D222), S234 (= S226), M235 (= M227), C270 (= C262), L271 (= L263), R297 (= R290)
1c9yA Human ornithine transcarbamylase: crystallographic insights into substrate recognition and catalytic mechanism (see paper)
41% identity, 98% coverage: 3:302/305 of query aligns to 4:309/321 of 1c9yA
- active site: R59 (= R52), T60 (= T53), V87 (≠ R80), R108 (= R101), H135 (= H128), Q138 (= Q131), D230 (= D222), C270 (= C262), R297 (= R290)
- binding phosphoric acid mono(formamide)ester: S57 (= S50), T58 (= T51), R59 (= R52), T60 (= T53), R108 (= R101), C270 (= C262), L271 (= L263), R297 (= R290)
- binding norvaline: L130 (= L123), N166 (= N159), D230 (= D222), S234 (= S226), M235 (= M227)
Query Sequence
>Synpcc7942_2514 FitnessBrowser__SynE:Synpcc7942_2514
MGLAGRDLLTLADLSSAEVLEILELAATLKSGQTTVHCPKTLGLIFSKSSTRTRVSFSAA
IMQMGGQVLDLNPNVTQVGRGEPIADTARVLSRYLDALAIRTFAQQDLEEYAHYADIPVI
NALTDDYHPCQILADLQTIQENFGQWQDLTLTYLGDGNNVAHSLLLGCAQVGMNVRIACP
PDYQPQERIVAKAQQIAGDRAKVEILHDPIAASQGAHVLYTDVWASMGQEEEAQARVKAF
TPYQLNQALLEKADPAAIVLHCLPAHREEEITAEVLEGSQSRVWDQAENRLHAQKAVLAL
LLGAI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory