Comparing Synpcc7942_2574 FitnessBrowser__SynE:Synpcc7942_2574 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
34% identity, 91% coverage: 12:239/251 of query aligns to 3:233/240 of 6mjpA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
33% identity, 91% coverage: 11:239/251 of query aligns to 2:233/233 of 6b8bA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 91% coverage: 11:239/251 of query aligns to 2:233/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
33% identity, 91% coverage: 11:239/251 of query aligns to 2:233/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
33% identity, 91% coverage: 11:239/251 of query aligns to 2:233/234 of 4p31A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 91% coverage: 11:239/251 of query aligns to 2:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 91% coverage: 11:239/251 of query aligns to 2:233/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
33% identity, 91% coverage: 11:239/251 of query aligns to 3:234/241 of 6mbnA
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
35% identity, 96% coverage: 11:251/251 of query aligns to 11:257/265 of P07821
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 89% coverage: 12:234/251 of query aligns to 4:231/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 89% coverage: 12:234/251 of query aligns to 4:231/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 89% coverage: 12:234/251 of query aligns to 4:231/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 89% coverage: 12:234/251 of query aligns to 4:231/242 of 2oljA
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
34% identity, 85% coverage: 33:245/251 of query aligns to 21:238/248 of 4fi3C
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 85% coverage: 14:226/251 of query aligns to 4:220/240 of 4ymuJ
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
30% identity, 83% coverage: 9:216/251 of query aligns to 8:225/257 of P0AAH0
Sites not aligning to the query:
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
34% identity, 83% coverage: 33:240/251 of query aligns to 21:230/231 of 1l7vC
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 86% coverage: 10:226/251 of query aligns to 1:220/241 of 4u00A
4zirB Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
32% identity, 76% coverage: 12:203/251 of query aligns to 4:189/247 of 4zirB
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
31% identity, 76% coverage: 12:203/251 of query aligns to 5:193/249 of 4hluC
>Synpcc7942_2574 FitnessBrowser__SynE:Synpcc7942_2574
MSQASAPNPPTLQAHHLSASYRDREVLQDVNLQLRAGQVVGIVGPNGAGKSTFLKALLGL
VPHQGEVFWRGLPLASRLPHVAYVPQRAQVDFDYPATVWDVVLMGRVAQTGWLRRFSAAS
QQAVKAALDRVELWDLRSRPIGELSGGQQQRVFIARSLAQEAELFLLDEPFAGIDRRSEG
LLYEILRDLAQQGHGVVVVHHDLGQAIQQFDELVLLNQRVIAQGHPRLVLQPDHLARAYG
ARLDITRYEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory