Comparing Synpcc7942_2582 FitnessBrowser__SynE:Synpcc7942_2582 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9M8S8 Inositol-phosphate phosphatase; L-galactose 1-phosphate phosphatase; Myo-inositol monophosphatase; EC 3.1.3.25; EC 3.1.3.93 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
42% identity, 84% coverage: 36:264/273 of query aligns to 34:266/271 of Q9M8S8
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
37% identity, 91% coverage: 9:256/273 of query aligns to 5:253/270 of 6ib8B
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
37% identity, 91% coverage: 9:256/273 of query aligns to 1:249/267 of P0ADG4
Sites not aligning to the query:
6tqoT Rrn anti-termination complex (see paper)
37% identity, 91% coverage: 9:256/273 of query aligns to 1:241/255 of 6tqoT
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
37% identity, 91% coverage: 9:256/273 of query aligns to 1:249/262 of 2qflA
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
39% identity, 92% coverage: 13:264/273 of query aligns to 4:254/258 of 3lv0A
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
34% identity, 96% coverage: 10:271/273 of query aligns to 2:268/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
34% identity, 96% coverage: 10:271/273 of query aligns to 2:268/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
34% identity, 96% coverage: 10:271/273 of query aligns to 2:268/272 of 1awbA
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
34% identity, 96% coverage: 10:271/273 of query aligns to 6:272/277 of P29218
6zk0AAA human impase with ebselen (see paper)
34% identity, 96% coverage: 10:271/273 of query aligns to 3:269/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
34% identity, 96% coverage: 10:271/273 of query aligns to 4:270/274 of 4as4A
6giuA Human impase with l-690330 (see paper)
34% identity, 96% coverage: 10:271/273 of query aligns to 4:270/275 of 6giuA
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
33% identity, 96% coverage: 10:271/273 of query aligns to 4:270/274 of 2bjiA
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
33% identity, 96% coverage: 10:271/273 of query aligns to 6:272/277 of P20456
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
38% identity, 92% coverage: 13:264/273 of query aligns to 4:236/238 of 3luzA
Sites not aligning to the query:
4as5A Structure of mouse inositol monophosphatase 1 (see paper)
32% identity, 96% coverage: 10:271/273 of query aligns to 4:270/274 of 4as5A
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
33% identity, 95% coverage: 10:269/273 of query aligns to 2:266/266 of 1imdA
O55023 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Mus musculus (Mouse) (see paper)
32% identity, 96% coverage: 10:271/273 of query aligns to 6:272/277 of O55023
3luzB Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
38% identity, 92% coverage: 13:264/273 of query aligns to 6:232/234 of 3luzB
Sites not aligning to the query:
>Synpcc7942_2582 FitnessBrowser__SynE:Synpcc7942_2582
VTAISDRLLQIWLDVATEAALAAGAELDRFWGRLTQIEEKGRPGDLLTEADRAAEAAVLS
VLERHCPDHAVLAEESGWSGDRQQEFSWAVDPLDGTTNYAHGYPFCGTSIALLYQNQPIV
GVFYAPYLKELFRAAQGLGATLNRQPIRVSKTEKLAKSLLVTGFAYDRCEVEDNNYAEFC
RLTHVTQGVRRGGSAALDLSYVACGRLDGYWERGLSPWDLAAGVVLVQEAGGLVTAYDRS
PFDISSGRILATNGQIHAELSETLLQIKPLQAF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory