Comparing Synpcc7942_B2619 FitnessBrowser__SynE:Synpcc7942_B2619 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
3lasA Crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution
43% identity, 95% coverage: 1:182/192 of query aligns to 3:165/166 of 3lasA
6jqcA The structural basis of the beta-carbonic anhydrase cafc (wild type) of the filamentous fungus aspergillus fumigatus (see paper)
46% identity, 84% coverage: 21:182/192 of query aligns to 20:160/164 of 6jqcA
P9WPJ7 Beta-carbonic anhydrase 1; Beta-CA 1; Carbonate dehydratase 1; mtCA 1; EC 4.2.1.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
39% identity, 95% coverage: 1:182/192 of query aligns to 1:161/163 of P9WPJ7
4yf4A Crystal structure of rv1284 in the presence of polycarpine at mildly acidic ph (see paper)
39% identity, 94% coverage: 2:182/192 of query aligns to 2:161/163 of 4yf4A
H1AAP2 Carbonyl sulfide hydrolase; COSase; EC 3.13.1.7 from Thiobacillus thioparus (see paper)
35% identity, 92% coverage: 7:182/192 of query aligns to 9:209/219 of H1AAP2
3vqjA Crystal structutre of thiobacillus thioparus thi115 carbonyl sulfide hydrolase (see paper)
35% identity, 92% coverage: 7:182/192 of query aligns to 5:205/213 of 3vqjA
G0WXL9 Carbon disulfide hydrolase; CS(2) hydrolase; Carbon disulfide lyase; EC 3.13.1.5 from Acidianus sp. (strain A1-3) (see paper)
32% identity, 92% coverage: 3:179/192 of query aligns to 1:182/204 of G0WXL9
Sites not aligning to the query:
3tenA Holo form of carbon disulfide hydrolase (see paper)
35% identity, 80% coverage: 26:179/192 of query aligns to 22:180/201 of 3tenA
1g5cA Crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum (see paper)
33% identity, 92% coverage: 3:179/192 of query aligns to 1:162/169 of 1g5cA
1g5cF Crystal structure of the 'cab' type beta class carbonic anhydrase from methanobacterium thermoautotrophicum (see paper)
35% identity, 78% coverage: 31:179/192 of query aligns to 11:148/155 of 1g5cF
Sites not aligning to the query:
6y04A Crystal structure of beta-carbonic anhydrase isoform i (tvaca1) from the trichomonas vaginalis protozoan. (see paper)
33% identity, 95% coverage: 1:182/192 of query aligns to 1:178/182 of 6y04A
>Synpcc7942_B2619 FitnessBrowser__SynE:Synpcc7942_B2619
MTVLTEVLEANQAYAAAFGEKGSLALPPARQFAILTCMDARLDPAQYAGLKEGDAHVIRN
AGGRASDDAIRSLVISYKLLGTKEWFVIHHTDCGMEFFTNSVIGSLLANSLETAVLRSDG
FTDIGEGPGSEEGKYIHWLTIENQTQSVVEDVQRIRRHPLVPSNIPIYGYLYDVRSGRLI
EVPEATTAGVAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory