Comparing Synpcc7942_B2664 FitnessBrowser__SynE:Synpcc7942_B2664 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0ABK5 Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine sulfhydrylase A; S-carboxymethylcysteine synthase; Sulfate starvation-induced protein 5; SSI5; EC 2.5.1.47; EC 4.5.1.5 from Escherichia coli (strain K12) (see 5 papers)
69% identity, 97% coverage: 7:326/329 of query aligns to 4:321/323 of P0ABK5
Sites not aligning to the query:
P0A1E3 Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine sulfhydrylase A; EC 2.5.1.47 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
69% identity, 97% coverage: 7:326/329 of query aligns to 4:321/323 of P0A1E3
Sites not aligning to the query:
6z4nAAA structure of oass complexed with upar inhibitor (see paper)
69% identity, 97% coverage: 7:324/329 of query aligns to 5:320/321 of 6z4nAAA
1d6sA Crystal structure of the k41a mutant of o-acetylserine sulfhydrylase complexed in external aldimine linkage with methionine (see paper)
68% identity, 97% coverage: 7:326/329 of query aligns to 3:320/322 of 1d6sA
1fcjA Crystal structure of oass complexed with chloride and sulfate (see paper)
68% identity, 92% coverage: 7:308/329 of query aligns to 3:302/302 of 1fcjA
5dbhX Crystal structure of o-acetylserine sulfhydrylase from haemophilus influenzae in complex with reaction intermediate alpha-aminoacrylate
66% identity, 95% coverage: 7:319/329 of query aligns to 2:312/312 of 5dbhX
1y7lA O-acetylserine sulfhydrylase complex (see paper)
66% identity, 95% coverage: 7:317/329 of query aligns to 2:310/310 of 1y7lA
5xoqA Crystal structure of o-acetylserine sulfhydrylase with bound transcription factor peptide inhibitor from planctomyces limnophilus
63% identity, 95% coverage: 8:320/329 of query aligns to 5:309/310 of 5xoqA
4zu6X Crystal structure of o-acetylserine sulfhydrylase from haemophilus influenzae in complex with pre-reactive o-acetyl serine, alpha- aminoacrylate reaction intermediate and peptide inhibitor at the resolution of 2.25a
66% identity, 95% coverage: 7:317/329 of query aligns to 3:309/309 of 4zu6X
4oreX Cyrstal structure of o-acetylserine sulfhydrylase ternary complex from haemophilus influenzae at 2.2 a
66% identity, 95% coverage: 7:317/329 of query aligns to 2:308/308 of 4oreX
P47999 Cysteine synthase, chloroplastic/chromoplastic; At.OAS.7-4; Beta-substituted Ala synthase 2;1; ARAth-Bsas2;1; CSase B; AtCS-B; CS-B; O-acetylserine (thiol)-lyase; O-acetylserine sulfhydrylase; OAS-TL B; cpACS1; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
60% identity, 97% coverage: 5:323/329 of query aligns to 72:384/392 of P47999
Sites not aligning to the query:
4aecA Crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyasE C (see paper)
59% identity, 97% coverage: 4:323/329 of query aligns to 9:322/323 of 4aecA
2q3dA 2.2 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) from mycobacterium tuberculosis in complex with the reaction intermediate alpha-aminoacrylate (see paper)
60% identity, 94% coverage: 10:317/329 of query aligns to 6:305/306 of 2q3dA
P9WP55 O-acetylserine sulfhydrylase; OAS sulfhydrylase; OASS; Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine-specific cysteine synthase; Sulfide-dependent cysteine synthase; EC 2.5.1.47 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
60% identity, 94% coverage: 10:317/329 of query aligns to 6:305/310 of P9WP55
3zeiA Structure of the mycobacterium tuberculosis o-acetylserine sulfhydrylase (oass) cysk1 in complex with a small molecule inhibitor (see paper)
60% identity, 92% coverage: 10:312/329 of query aligns to 6:300/300 of 3zeiA
2q3cA 2.1 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) holoenzyme from mycobacterium tuberculosis in complex with the inhibitory peptide dfsi (see paper)
60% identity, 92% coverage: 10:312/329 of query aligns to 6:300/300 of 2q3cA
4lmaA Crystal structure analysis of o-acetylserine sulfhydrylase cysk1 from microcystis aeruginosa 7806 (see paper)
59% identity, 95% coverage: 10:320/329 of query aligns to 6:311/318 of 4lmaA
7n2tA O-acetylserine sulfhydrylase from citrullus vulgaris in the internal aldimine state, with citrate bound (see paper)
58% identity, 96% coverage: 6:320/329 of query aligns to 2:309/309 of 7n2tA
P47998 Cysteine synthase 1; At.OAS.5-8; Beta-substituted Ala synthase 1;1; ARAth-Bsas1;1; CSase A; AtCS-A; Cys-3A; O-acetylserine (thiol)-lyase 1; OAS-TL A; O-acetylserine sulfhydrylase; Protein ONSET OF LEAF DEATH 3; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
56% identity, 95% coverage: 10:323/329 of query aligns to 8:314/322 of P47998
4lmbA Crystal structure analysis of o-acetylserine sulfhydrylase cysk2 complexed with cystine from microcystis aeruginosa 7806 (see paper)
58% identity, 94% coverage: 10:317/329 of query aligns to 6:308/310 of 4lmbA
>Synpcc7942_B2664 FitnessBrowser__SynE:Synpcc7942_B2664
MSTSGTFFADNSQTIGKTPLVRLNRIVKGAPATVLAKIEGRNPAYSVKCRIGAAMIWDAE
QRGLLGPGKELIEPTSGNTGIALAFVAAARGIPLTLTMPETMSLERRKLLAAYGAKLVLT
EGVKGMTGAVRRAEDIAASDPDRYVLLQQFRNPANPAIHEQTTGPEIWEDTGGAIDILVS
GVGTGGTITGVSRYIKQTQGKPILSVAVEPEASPVISQQRSGLPLKPGPHKIQGIGAGFI
PENLDLSLVDQVERVSNEEAIAYARRLAQEEGLISGISCGAAVAAAVRLAQQSEHAGKTI
VVVLPDSGERYLSTALFDGIFNEQGLAVV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory