Comparing U31H_SCYTH / A0A0A0VBR5 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
A0A0A0VBR5 U3-scytotoxin-Sth1h; U3-SYTX-Sth1h; U3-Sth1h from Scytodes thoracica (Spitting spider) (Aranea thoracica) (see paper)
100% identity, 100% coverage: 1:71/71 of query aligns to 1:71/71 of A0A0A0VBR5
A0A0A0V662 U3-scytotoxin-Sth1a; U3-SYTX-Sth1a; U3-Sth1a from Scytodes thoracica (Spitting spider) (Aranea thoracica) (see 2 papers)
78% identity, 83% coverage: 11:69/71 of query aligns to 1:59/60 of A0A0A0V662
Sites not aligning to the query:
>U31H_SCYTH / A0A0A0VBR5
MSQNSITSYKMGFAKHFFLFAVLLCATAMYSVAEPAQERLIESIACMQKGLPCMEHVDCC
HGVCDSLFCLY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory