Comparing WP_001036146.1 NCBI__GCF_000382825.1:WP_001036146.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
6ya4A Crystal structure of pnra from s. Pneumoniae in complex with cytidine (see paper)
94% identity, 89% coverage: 41:351/351 of query aligns to 22:332/332 of 6ya4A
6y9uA Crystal structure of pnra from s. Pneumoniae in complex with adenosine (see paper)
94% identity, 89% coverage: 41:351/351 of query aligns to 22:332/332 of 6y9uA
6ya3A Crystal structure of pnra from s. Pneumoniae in complex with guanosine (see paper)
94% identity, 89% coverage: 41:351/351 of query aligns to 21:331/331 of 6ya3A
6yabAAA Lipoprotein (see paper)
94% identity, 89% coverage: 41:351/351 of query aligns to 19:329/329 of 6yabAAA
6yagA Crystal structure of pnra from s. Pneumoniae in complex with thymidine (see paper)
94% identity, 88% coverage: 41:350/351 of query aligns to 20:329/329 of 6yagA
P29724 Membrane lipoprotein TmpC; Membrane protein C; 35 kDa antigen; Lipoprotein TpN35; Purine nucleoside receptor A; PnrA from Treponema pallidum (strain Nichols) (see 2 papers)
39% identity, 88% coverage: 43:351/351 of query aligns to 44:347/353 of P29724
Sites not aligning to the query:
2fqyA Pnra from treponema pallidum complexed with adenosine. (see paper)
39% identity, 88% coverage: 43:351/351 of query aligns to 7:310/316 of 2fqyA
2fqxA Pnra from treponema pallidum complexed with guanosine (see paper)
39% identity, 88% coverage: 43:351/351 of query aligns to 7:310/316 of 2fqxA
2fqwA Pnra from treponema pallidum as purified from e. Coli (bound to inosine) (see paper)
39% identity, 88% coverage: 43:351/351 of query aligns to 7:310/316 of 2fqwA
7x0rB Crystal structure of substrate binding protein lbp complexed wtih guanosine from clostridium thermocellum (see paper)
38% identity, 89% coverage: 38:350/351 of query aligns to 3:296/313 of 7x0rB
Sites not aligning to the query:
P0CL55 Basic membrane protein D; Probable substrate-binding protein BmpD from Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) (Borrelia burgdorferi) (see paper)
33% identity, 91% coverage: 30:349/351 of query aligns to 16:326/341 of P0CL55
6shuA Borrelia burgdorferi bmpd nucleoside binding protein bound to adenosine (see paper)
33% identity, 90% coverage: 35:349/351 of query aligns to 2:303/316 of 6shuA
4pevA Crystal structure of abc transporter system solute-binding proteins from aeropyrum pernix k1
26% identity, 87% coverage: 43:347/351 of query aligns to 6:343/370 of 4pevA
6pi6A The evolving story of atzt, a periplasmic binding protein (see paper)
33% identity, 46% coverage: 69:228/351 of query aligns to 30:190/333 of 6pi6A
Sites not aligning to the query:
6piiC The evolving story of atzt, a periplasmic binding protein (see paper)
33% identity, 46% coverage: 69:228/351 of query aligns to 30:190/331 of 6piiC
Sites not aligning to the query:
6piiA The evolving story of atzt, a periplasmic binding protein (see paper)
33% identity, 46% coverage: 69:228/351 of query aligns to 33:193/336 of 6piiA
Sites not aligning to the query:
3s99A Crystal structure of a basic membrane lipoprotein from brucella melitensis, iodide soak
24% identity, 76% coverage: 79:346/351 of query aligns to 39:288/330 of 3s99A
Sites not aligning to the query:
>WP_001036146.1 NCBI__GCF_000382825.1:WP_001036146.1
MNKKQWLGLGLVAVAAVGLAACGNRSSRNAASSSSEMKTKAAIVTDTGGVDDKSFNQSAW
EGLQDWGKEHNLSKDKGFTYFQSTSEADYANNLQQAAGSYNLIFGVGFALHNAVEEAAKD
HSDLNYVLIDDVIKDQKNVASVTFADNEAAYLAGVAAAKTTKTKQVGFVGGIESEVISRF
AAGFKAGVASVDPSIKVQVDYAGSFGDAAKGKTIAAAQYAAGADVVYQAAGGTGAGVFAE
AKSLNESKNENEKVWVIGVDRDQAAEGKYTSKDGKESNFVLVSTLKQVGTTVKDIANKTE
KGEFPGGQVIVYSLKDKGVDLAVTNLSEEGKKAVEDAKAKILDGSVKVPEK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory