SitesBLAST
Comparing WP_002894255.1 NCBI__GCF_000025465.1:WP_002894255.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
35% identity, 90% coverage: 31:337/342 of query aligns to 33:312/533 of O43175
- T78 (≠ A75) binding
- R135 (≠ Y158) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ NI 178:179) binding
- D175 (= D198) binding
- T207 (≠ L230) binding
- CAR 234:236 (≠ TSR 257:259) binding
- D260 (= D283) binding
- V261 (= V284) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIAG 308:311) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
35% identity, 89% coverage: 31:334/342 of query aligns to 29:305/305 of 6plfA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
35% identity, 86% coverage: 31:325/342 of query aligns to 28:295/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V174), G147 (= G175), L148 (≠ Y176), G149 (= G177), R150 (≠ N178), I151 (= I179), G152 (= G180), D170 (= D198), H201 (= H229), T202 (≠ L230), P203 (≠ S231)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
35% identity, 86% coverage: 31:325/342 of query aligns to 28:295/302 of 6rihA
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
35% identity, 86% coverage: 31:325/342 of query aligns to 25:292/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G177), I148 (= I179), Y166 (≠ V197), D167 (= D198), P168 (= P199), I169 (≠ F200), I170 (≠ V201), H198 (= H229), T199 (≠ L230), L208 (= L239), R228 (= R259)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
35% identity, 86% coverage: 31:325/342 of query aligns to 27:294/297 of 6rj3A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
35% identity, 86% coverage: 31:325/342 of query aligns to 27:294/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N99), A100 (= A103), R149 (≠ N178), I150 (= I179), Y168 (≠ V197), D169 (= D198), P170 (= P199), I171 (≠ F200), H200 (= H229), T201 (≠ L230), P202 (≠ S231), T207 (≠ S236), C228 (≠ T257), A229 (≠ S258), R230 (= R259), H277 (= H308), G279 (≠ A310)
7dkmA Phgdh covalently linked to oridonin (see paper)
35% identity, 86% coverage: 31:325/342 of query aligns to 29:296/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ A75), A102 (= A103), G148 (= G175), R151 (≠ N178), I152 (= I179), Y170 (≠ V197), D171 (= D198), P172 (= P199), I173 (≠ F200), H202 (= H229), T203 (≠ L230), P204 (≠ S231), T209 (≠ S236), C230 (≠ T257), A231 (≠ S258), R232 (= R259), H279 (= H308), G281 (≠ A310)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ A322)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
35% identity, 86% coverage: 31:325/342 of query aligns to 28:295/303 of 6plgA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
35% identity, 86% coverage: 31:325/342 of query aligns to 28:295/301 of 6rj5A
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
37% identity, 87% coverage: 38:334/342 of query aligns to 34:304/304 of 1wwkA
- active site: S96 (≠ N99), R230 (= R259), D254 (= D283), E259 (= E288), H278 (= H308)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ A103), G146 (= G175), F147 (≠ Y176), G148 (= G177), R149 (≠ N178), I150 (= I179), Y168 (≠ V197), D169 (= D198), P170 (= P199), V201 (≠ L230), P202 (≠ S231), T207 (≠ S236), T228 (= T257), S229 (= S258), D254 (= D283), H278 (= H308), G280 (≠ A310)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
34% identity, 87% coverage: 38:335/342 of query aligns to 38:315/334 of 5aovA
- active site: L100 (≠ N99), R241 (= R259), D265 (= D283), E270 (= E288), H288 (= H308)
- binding glyoxylic acid: M52 (≠ S52), L53 (≠ Y53), L53 (≠ Y53), Y74 (≠ T73), A75 (≠ R74), V76 (≠ A75), G77 (≠ N76), R241 (= R259), H288 (= H308)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A75), T104 (≠ A103), F158 (≠ Y176), G159 (= G177), R160 (≠ N178), I161 (= I179), S180 (≠ D198), R181 (≠ P199), A211 (≠ H229), V212 (≠ L230), P213 (≠ S231), T218 (≠ S236), I239 (≠ T257), A240 (≠ S258), R241 (= R259), H288 (= H308), G290 (≠ A310)
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
35% identity, 84% coverage: 39:325/342 of query aligns to 31:286/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ N178), Y160 (≠ V197), D161 (= D198), P162 (= P199), I164 (≠ V201), L179 (= L216), T193 (≠ L230), P194 (≠ S231), S198 (≠ H235), L202 (= L239)
2eklA Structure of st1218 protein from sulfolobus tokodaii
30% identity, 87% coverage: 32:328/342 of query aligns to 32:302/312 of 2eklA
- active site: S100 (≠ N99), R232 (= R259), D256 (= D283), E261 (= E288), H282 (= H308)
- binding nicotinamide-adenine-dinucleotide: I76 (≠ A75), S100 (≠ N99), G148 (= G175), G150 (= G177), R151 (≠ N178), I152 (= I179), Y170 (≠ V197), D171 (= D198), I172 (≠ P199), L173 (≠ F200), H202 (= H229), V203 (≠ L230), T204 (≠ S231), I212 (≠ L239), T230 (= T257), S231 (= S258), D256 (= D283), G284 (≠ A310)
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 88% coverage: 31:331/342 of query aligns to 39:315/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
34% identity, 88% coverage: 31:331/342 of query aligns to 33:309/404 of 1psdA
- active site: N102 (= N99), R234 (= R259), D258 (= D283), E263 (= E288), H286 (= H308)
- binding nicotinamide-adenine-dinucleotide: N102 (= N99), H155 (≠ N178), I156 (= I179), D175 (= D198), I176 (vs. gap), K179 (vs. gap), H204 (= H229), V205 (≠ L230), P206 (≠ S231), A232 (≠ T257), S233 (= S258), R234 (= R259), H286 (= H308)
Sites not aligning to the query:
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
34% identity, 88% coverage: 31:331/342 of query aligns to 35:311/406 of 1ybaA
- active site: N104 (= N99), R236 (= R259), D260 (= D283), E265 (= E288), H288 (= H308)
- binding 2-oxoglutaric acid: R56 (≠ T51), S57 (= S52), C79 (≠ R74), I80 (≠ A75)
- binding nicotinamide-adenine-dinucleotide: I80 (≠ A75), F102 (≠ G97), V108 (≠ A103), G154 (= G175), G156 (= G177), H157 (≠ N178), I158 (= I179), Y176 (≠ V197), D177 (= D198), I178 (vs. gap), K181 (vs. gap), H206 (= H229), V207 (≠ L230), P208 (≠ S231), A234 (≠ T257), S235 (= S258), R236 (= R259), H288 (= H308), G290 (≠ A310)
- binding phosphate ion: G81 (≠ N76), N83 (≠ V78)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
36% identity, 87% coverage: 39:335/342 of query aligns to 38:314/332 of 6biiA
- active site: L99 (≠ N99), R240 (= R259), D264 (= D283), E269 (= E288), H287 (= H308)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ A75), T103 (≠ A103), G156 (= G175), F157 (≠ Y176), G158 (= G177), R159 (≠ N178), I160 (= I179), A179 (≠ D198), R180 (≠ P199), S181 (≠ F200), K183 (≠ A202), V211 (≠ L230), P212 (≠ S231), E216 (≠ H235), T217 (≠ S236), V238 (≠ T257), A239 (≠ S258), R240 (= R259), D264 (= D283), H287 (= H308), G289 (≠ A310)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
29% identity, 98% coverage: 1:335/342 of query aligns to 1:321/334 of 3kb6B
- active site: S97 (≠ N99), R231 (= R259), D255 (= D283), E260 (= E288), H294 (= H308)
- binding lactic acid: F49 (≠ T51), S72 (≠ R74), V73 (≠ A75), G74 (≠ N76), Y96 (≠ R98), R231 (= R259), H294 (= H308)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ A75), Y96 (≠ R98), V101 (≠ A103), G150 (= G177), R151 (≠ N178), I152 (= I179), D171 (= D198), V172 (≠ F200), P203 (≠ S231), T229 (= T257), A230 (≠ S258), R231 (= R259), H294 (= H308), A296 (= A310), Y297 (≠ G311)
7cvpA The crystal structure of human phgdh from biortus.
35% identity, 70% coverage: 89:328/342 of query aligns to 41:252/254 of 7cvpA
- binding nicotinamide-adenine-dinucleotide: G101 (= G175), G103 (= G177), R104 (≠ N178), I105 (= I179), Y123 (≠ V197), D124 (= D198), P125 (= P199), I126 (≠ F200), H155 (= H229), T156 (≠ L230), P157 (≠ S231), T162 (≠ S236), C183 (≠ T257), A184 (≠ S258), R185 (= R259), H232 (= H308), G234 (≠ A310)
Query Sequence
>WP_002894255.1 NCBI__GCF_000025465.1:WP_002894255.1
MKIVFTAEHAGDLSAFHQLGELLVEGWALGKPKLSAGQLIELAHDAEVLVTSYDEVTDAV
MAACPRLQVIACTRANPVNIDTQAAQARGIRVLYTPGRNADAAAELTLGLMLSLARHIPQ
SHAALKRGEFTQADNAAAATQQGLRRDVVWDVSPESPYEVFKGSELRNKTLGLVGYGNIG
RRVARIARAFGMAVLVVDPFVAAEDINEPGLQKTTLEALFREADIVSLHLSSGPHSDGLV
NAALLNSMKPGALLINTSRAAVVDEAALIDALRHGPLGGAALDVYHREPLWRDHPFVIEF
DNVIITPHIAGATRESIAKHTAMIAADLQRYVAGEPLLYQWR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory