SitesBLAST
Comparing WP_002963614.1 NCBI__GCF_000022745.1:WP_002963614.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
51% identity, 100% coverage: 1:245/245 of query aligns to 3:247/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ T15), R18 (≠ G16), I20 (≠ L18), T40 (= T38), N62 (= N60), V63 (≠ L61), N89 (= N87), A90 (= A88), I92 (= I90), V139 (≠ I137), S141 (= S139), Y154 (= Y152), K158 (= K156), P184 (= P182), G185 (= G183), I187 (= I185), T189 (≠ S187), M191 (= M189)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
52% identity, 100% coverage: 2:245/245 of query aligns to 1:244/244 of P0AEK2
- GASR 12:15 (≠ GATG 13:16) binding NADP(+)
- T37 (= T38) binding NADP(+)
- NV 59:60 (≠ NL 60:61) binding NADP(+)
- N86 (= N87) binding NADP(+)
- Y151 (= Y152) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YCASK 152:156) binding NADP(+)
- A154 (≠ S155) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K156) mutation to A: Defect in the affinity for NADPH.
- I184 (= I185) binding NADP(+)
- E233 (≠ Q234) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
52% identity, 99% coverage: 3:245/245 of query aligns to 1:243/243 of 1q7bA
- active site: G15 (= G17), E101 (≠ D103), S137 (= S139), Q147 (= Q149), Y150 (= Y152), K154 (= K156)
- binding calcium ion: E232 (≠ Q234), T233 (= T235)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ T15), R14 (≠ G16), T36 (= T38), N58 (= N60), V59 (≠ L61), N85 (= N87), A86 (= A88), G87 (= G89), I88 (= I90), S137 (= S139), Y150 (= Y152), K154 (= K156), P180 (= P182), G181 (= G183), I183 (= I185)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
51% identity, 99% coverage: 3:245/245 of query aligns to 1:243/243 of 1q7cA
- active site: G15 (= G17), S137 (= S139), Q147 (= Q149), F150 (≠ Y152), K154 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G13), S13 (≠ T15), R14 (≠ G16), A35 (≠ G37), T36 (= T38), L57 (≠ A59), N58 (= N60), V59 (≠ L61), G87 (= G89), I88 (= I90)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
52% identity, 98% coverage: 6:245/245 of query aligns to 5:244/244 of P0A2C9
- M125 (= M126) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A224) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S225) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
51% identity, 98% coverage: 6:245/245 of query aligns to 5:244/244 of 6t77A
- active site: G16 (= G17), S138 (= S139), Y151 (= Y152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ T15), R15 (≠ G16), T37 (= T38), L58 (≠ A59), N59 (= N60), V60 (≠ L61), A87 (= A88), G88 (= G89), I89 (= I90)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
50% identity, 100% coverage: 1:245/245 of query aligns to 3:243/243 of 4i08A
- active site: G19 (= G17), N113 (= N111), S141 (= S139), Q151 (= Q149), Y154 (= Y152), K158 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ T15), R18 (≠ G16), I20 (≠ L18), T40 (= T38), N62 (= N60), V63 (≠ L61), N89 (= N87), A90 (= A88), G140 (≠ T138), S141 (= S139), Y154 (= Y152), K158 (= K156), P184 (= P182), G185 (= G183), T189 (≠ S187)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
51% identity, 98% coverage: 6:245/245 of query aligns to 4:243/243 of 7emgB
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
49% identity, 97% coverage: 7:244/245 of query aligns to 5:246/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
49% identity, 97% coverage: 7:244/245 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G17), S138 (= S139), Q148 (= Q149), Y151 (= Y152), K155 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ T15), R11 (≠ G16), I13 (≠ L18), N31 (≠ H36), Y32 (vs. gap), A33 (vs. gap), G34 (= G37), S35 (≠ T38), A58 (= A59), N59 (= N60), V60 (≠ L61), N86 (= N87), A87 (= A88), T109 (≠ V110), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (= G183)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
48% identity, 98% coverage: 4:244/245 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G17), S142 (= S139), Q152 (= Q149), Y155 (= Y152), K159 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ T15), R15 (≠ G16), G16 (= G17), I17 (≠ L18), N35 (≠ G34), Y36 (≠ L35), N37 (≠ H36), G38 (= G37), S39 (≠ T38), N63 (= N60), V64 (≠ L61), N90 (= N87), A91 (= A88), I93 (= I90), I113 (≠ V110), S142 (= S139), Y155 (= Y152), K159 (= K156), P185 (= P182), I188 (= I185), T190 (≠ S187)
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
47% identity, 99% coverage: 2:244/245 of query aligns to 8:253/254 of 4ag3A
- active site: G23 (= G17), S148 (= S139), Y161 (= Y152), K165 (= K156)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G13), S21 (≠ T15), R22 (≠ G16), G23 (= G17), I24 (≠ L18), T44 (≠ L35), L68 (≠ A59), D69 (≠ N60), V70 (≠ L61), N96 (= N87), A97 (= A88), I146 (= I137), S148 (= S139), Y161 (= Y152), K165 (= K156), P191 (= P182), G192 (= G183), F193 (= F184), I194 (= I185), T196 (≠ S187), M198 (= M189), T199 (= T190)
6t62A Crystal structure of acinetobacter baumannii fabg in complex with NADPH at 1.8 a resolution (see paper)
45% identity, 96% coverage: 9:244/245 of query aligns to 8:243/244 of 6t62A
- active site: G16 (= G17), S138 (= S139), Y151 (= Y152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ T15), R15 (≠ G16), A36 (≠ G37), T37 (= T38), L58 (≠ A59), D59 (≠ N60), V60 (≠ L61), N86 (= N87), A87 (= A88), G88 (= G89), I89 (= I90), I136 (= I137), S137 (≠ T138), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (= G183), I184 (= I185), M188 (= M189)
6wprA Crystal structure of a putative 3-oxoacyl-acp reductase (fabg) with NADP(h) from acinetobacter baumannii (see paper)
45% identity, 96% coverage: 9:244/245 of query aligns to 8:243/244 of 6wprA
- active site: G16 (= G17), S138 (= S139), Y151 (= Y152)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (≠ T15), R15 (≠ G16), T37 (= T38), L58 (≠ A59), D59 (≠ N60), V60 (≠ L61), N86 (= N87), A87 (= A88), G88 (= G89), I89 (= I90), I136 (= I137), Y151 (= Y152), K155 (= K156), P181 (= P182)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
47% identity, 96% coverage: 10:244/245 of query aligns to 5:244/244 of 1edoA
- active site: G12 (= G17), S138 (= S139), Y151 (= Y152), K155 (= K156)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), S10 (≠ T15), R11 (≠ G16), I13 (≠ L18), N31 (≠ H36), Y32 (≠ G37), A33 (≠ T38), R34 (= R39), S35 (vs. gap), D59 (≠ N60), V60 (≠ L61), N86 (= N87), A87 (= A88), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (= G183), I184 (= I185), S186 (= S187), M188 (= M189)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain ATCC 27184 / PCC 6803 / Kazusa) (see paper)
47% identity, 100% coverage: 1:245/245 of query aligns to 1:247/247 of P73574
- A14 (= A14) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P147) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K156) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (= F184) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (= N194) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
3tzcA Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg)(y155f) from vibrio cholerae (see paper)
45% identity, 99% coverage: 1:242/245 of query aligns to 3:223/224 of 3tzcA
4bo4C Crystal structure of 3-oxoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with n-(2-methoxyphenyl)-3,4- dihydro-2h-quinoline-1-carboxamide at 2.7a resolution (see paper)
46% identity, 99% coverage: 2:244/245 of query aligns to 14:254/255 of 4bo4C
P14697 Acetoacetyl-CoA reductase; EC 1.1.1.36 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see 2 papers)
42% identity, 98% coverage: 4:244/245 of query aligns to 1:245/246 of P14697
- GGI 13:15 (≠ GGL 16:18) binding NADP(+)
- G35 (= G34) binding NADP(+)
- R40 (= R39) binding NADP(+)
- Q47 (≠ L46) mutation to L: 2.4-fold increase in activity. 2-fold decrease in affinity for NADPH and 2.8-fold decrease in affinity for acetoacetyl-CoA.
- GNV 60:62 (≠ ANL 59:61) binding NADP(+)
- NAGIT 88:92 (= NAGIT 87:91) binding NADP(+)
- D94 (= D93) mutation to A: About 6% of wild-type activity.
- K99 (≠ R98) mutation to A: Nearly loss of activity.
- Q147 (≠ N146) mutation to A: About 30% of wild-type activity.
- F148 (≠ P147) mutation to A: About 30% of wild-type activity.
- Q150 (= Q149) mutation to A: About 20% of wild-type activity.
- T173 (≠ S172) mutation to S: 3.5-fold increase in activity. 4-fold decrease in affinity for NADPH and 2.4-fold decrease in affinity for acetoacetyl-CoA.
- PGYI 183:186 (≠ PGFI 182:185) binding NADP(+)
- Y185 (≠ F184) mutation to A: Nearly loss of activity.
- R195 (≠ N194) mutation to A: Nearly loss of activity.
3vzsB Crystal structure of phab from ralstonia eutropha in complex with acetoacetyl-coa and NADP (see paper)
42% identity, 98% coverage: 5:244/245 of query aligns to 5:248/249 of 3vzsB
- active site: N115 (= N111), S143 (= S139), Y156 (= Y152), K160 (= K156)
- binding acetoacetyl-coenzyme a: D97 (= D93), Q150 (≠ N146), F151 (≠ P147), Q153 (= Q149), Y156 (= Y152), G187 (= G183), Y188 (≠ F184), R198 (≠ N194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), I18 (≠ L18), G38 (= G34), R43 (= R39), G63 (≠ A59), N64 (= N60), V65 (≠ L61), G93 (= G89), I94 (= I90), T95 (= T91), P186 (= P182), I189 (= I185), M193 (= M189), V194 (≠ T190)
Query Sequence
>WP_002963614.1 NCBI__GCF_000022745.1:WP_002963614.1
MFDLTGRKALVTGATGGLGEAIARALHAQGAIVGLHGTREEKLKELAAELGERIFVFPAN
LSDREAVKALGQKAEEEMGGVDILVNNAGITRDGLFVRMSDEDWDAVLTVNLTSVFNLTR
ELTHPMMRRRNGRIINITSIVGVTGNPGQANYCASKAGLIGFSKSLAQEIASRNVTVNCI
APGFIESAMTGKLNEKQKDAIMGNIPMKRMGVGADIAAAVVYLASDEAAYVTGQTLHVNG
GMAMI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory