Comparing WP_002965064.1 NCBI__GCF_000182725.1:WP_002965064.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P60844 Aquaporin Z; Bacterial nodulin-like intrinsic protein; Water channel AqpZ from Escherichia coli (strain K12) (see paper)
71% identity, 91% coverage: 1:207/228 of query aligns to 1:209/231 of P60844
8uy6A Aquaporin z with alfa tag and bound to nanobody (see paper)
71% identity, 91% coverage: 1:207/228 of query aligns to 1:209/244 of 8uy6A
2o9eA Crystal structure of aqpz mutant t183c complexed with mercury (see paper)
67% identity, 100% coverage: 1:228/228 of query aligns to 3:232/232 of 2o9eA
3nkaA Crystal structure of aqpz h174g,t183f (see paper)
70% identity, 91% coverage: 1:207/228 of query aligns to 3:211/230 of 3nkaA
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
38% identity, 97% coverage: 2:222/228 of query aligns to 37:245/271 of P08995
Sites not aligning to the query:
P55064 Aquaporin-5; AQP-5 from Homo sapiens (Human) (see 3 papers)
41% identity, 98% coverage: 2:225/228 of query aligns to 11:225/265 of P55064
5dyeD Crystal structure of the full length s156e mutant of human aquaporin 5 (see paper)
41% identity, 98% coverage: 2:225/228 of query aligns to 10:224/253 of 5dyeD
Q6J8I9 Lens fiber major intrinsic protein; Aquaporin-0 from Ovis aries (Sheep) (see 2 papers)
38% identity, 96% coverage: 7:225/228 of query aligns to 15:223/263 of Q6J8I9
Sites not aligning to the query:
P06624 Lens fiber major intrinsic protein; Aquaporin-0; MIP26; MP26 from Bos taurus (Bovine) (see 4 papers)
37% identity, 98% coverage: 3:225/228 of query aligns to 11:223/263 of P06624
Sites not aligning to the query:
Q9XF58 Aquaporin PIP2-5; Plasma membrane intrinsic protein 2-5; ZmPIP2-5; ZmPIP2;5; ZmPIP2a from Zea mays (Maize) (see paper)
38% identity, 85% coverage: 33:225/228 of query aligns to 77:270/285 of Q9XF58
P29972 Aquaporin-1; AQP-1; Aquaporin-CHIP; Channel-like integral membrane protein of 28 kDa; Urine water channel from Homo sapiens (Human) (see 4 papers)
38% identity, 96% coverage: 7:225/228 of query aligns to 16:231/269 of P29972
Sites not aligning to the query:
8sjxA Structure of lens aquaporin-0 array in sphingomyelin/cholesterol bilayer (2sm:1chol) (see paper)
38% identity, 96% coverage: 7:225/228 of query aligns to 10:218/220 of 8sjxA
Sites not aligning to the query:
8ct2D Local refinement of aqp1 tetramer (c1; refinement mask included d1 of protein 4.2 and ankyrin-1 ar1-5) in class 2 of erythrocyte ankyrin-1 complex (see paper)
38% identity, 96% coverage: 7:225/228 of query aligns to 14:229/247 of 8ct2D
Q08733 Aquaporin PIP1-3; AtPIP1;3; Plasma membrane intrinsic protein 1c; PIP1c; Transmembrane protein B; TMP-B from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 93% coverage: 7:219/228 of query aligns to 56:271/286 of Q08733
Sites not aligning to the query:
P56402 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Mus musculus (Mouse) (see 2 papers)
38% identity, 96% coverage: 7:225/228 of query aligns to 15:223/271 of P56402
Sites not aligning to the query:
Q06611 Aquaporin PIP1-2; AtPIP1;2; Plasma membrane intrinsic protein 1b; PIP1b; Transmembrane protein A; AthH2; TMP-A from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 93% coverage: 7:219/228 of query aligns to 56:271/286 of Q06611
Sites not aligning to the query:
P30302 Aquaporin PIP2-3; Plasma membrane intrinsic protein 2-3; AtPIP2;3; Plasma membrane intrinsic protein 2c; PIP2c; RD28-PIP; TMP2C; Water stress-induced tonoplast intrinsic protein; WSI-TIP from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 85% coverage: 33:225/228 of query aligns to 75:268/285 of P30302
P43287 Aquaporin PIP2-2; Plasma membrane intrinsic protein 2-2; AtPIP2;2; Plasma membrane intrinsic protein 2b; PIP2b; TMP2b from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
36% identity, 85% coverage: 33:225/228 of query aligns to 75:268/285 of P43287
Sites not aligning to the query:
P43286 Aquaporin PIP2-1; Plasma membrane intrinsic protein 2-1; AtPIP2;1; Plasma membrane intrinsic protein 2a; PIP2a from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
36% identity, 85% coverage: 33:225/228 of query aligns to 77:270/287 of P43286
Sites not aligning to the query:
P61837 Aquaporin PIP1-1; AtPIP1;1; Plasma membrane aquaporin-1; Plasma membrane intrinsic protein 1a; PIP1a from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 93% coverage: 7:219/228 of query aligns to 56:271/286 of P61837
Sites not aligning to the query:
>WP_002965064.1 NCBI__GCF_000182725.1:WP_002965064.1
MLNKLSAEFFGTFWLVFGGCGSAILAAAFPELGIGFLGVALAFGLTVLTMAYAVGGISGG
HFNPAVSLGLTVAGRLPAKDLIPYWVAQVLGAIAAAAILYVIASGKDGFSAGGLASNGYG
ELSPGGYSMMAGLLIEIILTAFFIIIILGSTSSLAPAGFAPIAIGFGLTLIHLVSIPVTN
TSVNPARSTGVALFADTAALSQLWLFWVAPLVGAVIGAIIWKGLLGRD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory