Comparing WP_003542336.1 NCBI__GCF_000009265.1:WP_003542336.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
55% identity, 96% coverage: 6:242/247 of query aligns to 1:237/240 of 1ji0A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
35% identity, 94% coverage: 11:242/247 of query aligns to 4:252/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
35% identity, 94% coverage: 11:242/247 of query aligns to 4:252/253 of 1g9xB
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 94% coverage: 11:242/247 of query aligns to 2:234/240 of 6mjpA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 92% coverage: 10:236/247 of query aligns to 16:240/378 of P69874
Sites not aligning to the query:
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 90% coverage: 21:242/247 of query aligns to 12:234/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
33% identity, 90% coverage: 21:242/247 of query aligns to 12:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
33% identity, 90% coverage: 21:242/247 of query aligns to 12:234/234 of 4p31A
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 90% coverage: 21:242/247 of query aligns to 12:234/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 90% coverage: 21:242/247 of query aligns to 12:234/238 of 6s8gA
8y5iA Cryo-em structure of e.Coli spermidine transporter potd-potabc in translocation intermidiate state (see paper)
30% identity, 92% coverage: 10:236/247 of query aligns to 1:225/358 of 8y5iA
6mbnA Lptb e163q in complex with atp (see paper)
33% identity, 90% coverage: 21:242/247 of query aligns to 13:235/241 of 6mbnA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
33% identity, 89% coverage: 21:241/247 of query aligns to 12:233/233 of 6b8bA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 88% coverage: 24:240/247 of query aligns to 18:237/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 88% coverage: 23:240/247 of query aligns to 18:238/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 88% coverage: 24:240/247 of query aligns to 19:238/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 88% coverage: 24:240/247 of query aligns to 19:238/344 of 3tuiC
Sites not aligning to the query:
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
31% identity, 94% coverage: 5:235/247 of query aligns to 4:243/257 of P0AAH0
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 92% coverage: 10:236/247 of query aligns to 1:228/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 90% coverage: 11:232/247 of query aligns to 1:224/240 of 4ymuJ
>WP_003542336.1 NCBI__GCF_000009265.1:WP_003542336.1
MGDEVMTGQPLLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGS
PQARTGSVVFEGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFA
EDVEKIFTLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVK
GIFEAIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAA
YLEGGRH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory