Comparing WP_004385842.1 NCBI__GCF_000319285.1:WP_004385842.1 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P69783 PTS system glucose-specific EIIA component; EIIA-Glc; EIII-Glc; Glucose-specific phosphotransferase enzyme IIA component from Escherichia coli (strain K12) (see 6 papers)
91% identity, 100% coverage: 1:167/167 of query aligns to 1:169/169 of P69783
1glcF Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
91% identity, 99% coverage: 2:167/167 of query aligns to 1:161/161 of 1glcF
1o2fA Complex of enzyme iiaglc and iibglc phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
97% identity, 90% coverage: 18:167/167 of query aligns to 1:150/150 of 1o2fA
P09323 PTS system N-acetylglucosamine-specific EIICBA component; EIICBA-Nag; EII-Nag; EC 2.7.1.193 from Escherichia coli (strain K12) (see paper)
50% identity, 89% coverage: 20:167/167 of query aligns to 500:648/648 of P09323
Sites not aligning to the query:
>WP_004385842.1 NCBI__GCF_000319285.1:WP_004385842.1
MGLFSKLFGDKGNSDTGTIEIVAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGNKMVA
PVDGTIGKIFETNHAFSIESDSGIELFVHFGIDTVELKGEGFKRIAEEGQRVKKGDPVIE
FDLPLLEEKAKSTLTPVVISNMDEIKELTKLSGSVTVGETPVIRIKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory